DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lu-2016-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268895X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-2 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268898X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268900X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268896X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-5 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268901X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268899X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation lu-2016-7 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268897X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions imex curation casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH car17_human Caspase recruitment domain-containing protein 17 CARD17 INCA Caspase-1 inhibitor INCA Inhibitory caspase recruitment domain protein protein protein human Homo sapiens Human MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS car18_human Caspase recruitment domain-containing protein 18 CARD18 ICEBERG UNQ5804/PRO19611 Caspase-1 inhibitor Iceberg protein protein human Homo sapiens Human MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH casp1-1 3291059 N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false casp1-card17-1 3291060 N/A 3291067 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3291066 unspecified role unspecified role bait bait Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false card18-casp1-1 3291061 N/A 3291068 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false card17-casp1-1 3291062 N/A 3291067 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false casp1-card18-1 3291063 N/A 3291068 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3291066 unspecified role unspecified role bait bait Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false card18-casp1-2 3291064 N/A 3291068 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false card17-casp1-2 3291065 N/A 3291067 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3291066 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false