DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tasselli-2016-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268902X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions imex curation tasselli-2016-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268904X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions imex curation tasselli-2016-3 in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268906X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions imex curation tasselli-2016-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268903X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions imex curation tasselli-2016-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268905X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions imex curation sir6_human NAD-dependent protein deacetylase sirtuin-6 SIR2-like protein 6 SIRT6 SIR2L6 Regulatory protein SIR2 homolog 6 protein protein human Homo sapiens Human MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS cenpa_human Histone H3-like centromeric protein A CENPA Centromere autoantigen A Centromere protein A protein protein human Homo sapiens Human MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG tif1b_human Transcription intermediary factor 1-beta TRIM28 KAP1 RNF96 TIF1B Tripartite motif-containing protein 28 Nuclear corepressor KAP-1 KRAB-associated protein 1 KRAB-interacting protein 1 RING finger protein 96 E3 SUMO-protein ligase TRIM28 RING-type E3 ubiquitin transferase TIF1-beta protein protein human Homo sapiens Human MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP h3(1027) Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) STGGKAPRKQLATKAARK af9_human Protein AF-9 ALL1-fused gene from chromosome 9 protein Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein YEATS domain-containing protein 3 MLLT3 AF9 YEATS3 protein protein human Homo sapiens Human MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS sirt6-cenpa-1 3291025 N/A 3291030 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3291031 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false h3(1027)-trim28-1 3291026 N/A 3291032 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3291033 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false PTM disrupting an interaction Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro direct interaction direct interaction false false false h3(1027)-sirt6-1 3291027 N/A 3291030 enzyme enzyme unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3291033 enzyme target enzyme target substrate substrate unspecified role unspecified role K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false in vitro In vitro deacetylation deacetylation reaction deacetylation false false false h3(1027)-trim28-2 3291028 N/A 3291032 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3291033 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false PTM disrupting an interaction Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro physical association physical association false false false h3(1027)-mllt3-1 3291029 N/A 3291034 unspecified role unspecified role prey prey Region 1-138 Region 1-138 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3291033 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false Prerequisite-PTM Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro direct interaction direct interaction false false false