DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ erbilgin-2016-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Erbilgin O., Sutter M., Kerfeld CA. DIP original experiment: DIP-268543X PLoS biology 2016 IMEx The Structural Basis of Coenzyme A Recycling in a Bacterial Organelle. Erbilgin O., Sutter M., Kerfeld CA. Only protein-protein interactions imex curation erbilgin-2016-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Erbilgin O., Sutter M., Kerfeld CA. DIP original experiment: DIP-268540X PLoS biology 2016 IMEx The Structural Basis of Coenzyme A Recycling in a Bacterial Organelle. Erbilgin O., Sutter M., Kerfeld CA. Only protein-protein interactions imex curation erbilgin-2016-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Erbilgin O., Sutter M., Kerfeld CA. DIP original experiment: DIP-268541X PLoS biology 2016 IMEx The Structural Basis of Coenzyme A Recycling in a Bacterial Organelle. Erbilgin O., Sutter M., Kerfeld CA. Only protein-protein interactions imex curation erbilgin-2016-4 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Erbilgin O., Sutter M., Kerfeld CA. DIP original experiment: DIP-268542X PLoS biology 2016 IMEx The Structural Basis of Coenzyme A Recycling in a Bacterial Organelle. Erbilgin O., Sutter M., Kerfeld CA. Only protein-protein interactions imex curation d5sxm0_plal2 Phosphate acyltransferase PduL Phosphate propanoyltransferase Phosphotransacylase PduL Propanediol utilization protein PduL Plim_1757 protein protein plal2 Planctopirus limnophila (strain ATCC 43296 / DSM 3776 / IFAM 1008 / 290) Planctomyces limnophilus MSSDSVVAGNISRADVERVVRAVLTRQLAGATTSSGSVSSAGGPPNPLVVNISARHVHLTEEHVEVLFGKGVKLEPMKWLYQDGYYAAKQTVTIFGPRRRMIPDVRVLGPCRNASQVELAFTDGISLGIDLPVRISGDHHDTVGCVLVGPAGVVELKSGVIRAMRHVHMSPADCAYYGVKNGDEMDLKIHSGPCTTTLEHVTVREDKDVKLEVHIDTDEGNAVDLSHATKVELVKPVGCGCHSK q21a54_rhopb Phosphate propanoyltransferase RPC_1169 protein protein rhopb Rhodopseudomonas palustris (strain BisB18) MDMQQETIERIIRQVLGQVGPAGGSIATLSGDAGVDPFQVAVGVSNRHIHLSRTDMDTLFGPGAELQRKKAMKQPGQFAAEETVTLKGPKGSLSKVRVLGPLRRETQVEVSVADGFALGITPPLRQSGQLDDTPGLTIIGPQGSVTKDHGVIVAQRHIHMHPSTAAKLGLRNGDEVDVEAGGERGGVMHRVLIRVAEASADEMHIDVEEANALCLKNDDVVRICKK d5sxm0_plal2-1 3290498 N/A 3290502 unspecified role unspecified role unspecified role unspecified role Region 21-244 Region 21-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q21a54_rhopb-1 3290499 N/A 3290503 unspecified role unspecified role unspecified role unspecified role Region 34-226 Region 34-226 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q21a54_rhopb-2 3290500 N/A 3290503 unspecified role unspecified role unspecified role unspecified role Region 48-226 Region 48-226 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q21a54_rhopb-3 3290501 N/A 3290503 unspecified role unspecified role unspecified role unspecified role Region 48-226 Region 48-226 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false