DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ robert-2016-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269056X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation robert-2016-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269059X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation robert-2016-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269057X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation robert-2016-4 ecolx Escherichia coli density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269061X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation robert-2016-5 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269060X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation robert-2016-6 ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. DIP original experiment: DIP-269058X Science (New York, N.Y.) 2016 IMEx The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation. Robert T., Nore A., Brun C., Maffre C., Crimi B., Bourbon HM., de Massy B. Only protein-protein interactions imex curation q9wtk8-1 Meiotic recombination protein SPO11 Spo11 Spo11beta Beta protein protein mouse Mus musculus Mouse MAFAPMGPEASFFDALDRHRASLLAMVKRGAGETPAGATRVASSSEVLTAIENIIQDIIKSLARNEVPAFTIDNRSSWENIMFDDSVGLRMIPQCTTRKIRSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDAKFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDTFHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTIPTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPYITYQPLWKKELEMMADSKMKAEIQALTLLSSDYLSRVYLPNKLRFGGWI to6bl_mouse Type 2 DNA topoisomerase 6 subunit B-like Top6bl Gm960 Type 2 DNA topoisomerase VI subunit B-like protein protein mouse Mus musculus Mouse MERTALAVCEILRYLIIHWKCEAGTAKGTLLDGQLVISIEALRSKHLPDSLHCIITIASTRSVYGGLNFKKFLQEIQPALPRLSAKLALASEEGGRSQDASGIAPCQVTFEVDENSQSLMTDCLVIKHFLRKIIIVHHKLKFSFSVAVNGTLSAETFGAENEPTLRLDNGVTLVVGFQRYVSKPKLNWSEAHCSRIHPVLGHPAPLFIPDAKADTGLLGELTLTPAAALCPSPKGFSSQLCRISSVSIFLYGPLGLPLLSSDQDQPSTAVFRDTSYFIDWKKYNLFMVPNLDLNLDTQSVLPDVNYKAESPEGNQSQNMNAQGPALLLFLFVDFQSDVPVQQAKIWGLHTLLTAHLSAILSESRSTVQQSIQSAVDQVWQLYHHDAKTQQRLQASLSVAVNSIMSVLTGSTRSSFRKTCLQALEAADTQEFGVKLHRIFYDITQHQFLKHCSCDTEQHLTPEKNISAQNTKDQHKNIAQEFPEESIGQAENKRPKRGSPNHGREESRVLGSARDRSPPKSATRDRELTEVSLTARGSQTQAAHGRAQAAEAASPAGGLEDLWLQEVSNLSEWLNPGHRS top6bl-spo11-1 3290363 N/A 3290369 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3290370 unspecified role unspecified role bait bait Region 474-733 Region 474-733 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false spo11-top6bl-1 3290364 N/A 3290369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290370 unspecified role unspecified role unspecified role unspecified role Region 155-733 Region 155-733 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false spo11-top6bl-2 3290365 N/A 3290369 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3290370 unspecified role unspecified role prey prey Region 474-733 Region 474-733 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false spo11-top6bl-3 3290366 N/A 3290369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290370 unspecified role unspecified role unspecified role unspecified role Region 155-733 Region 155-733 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false top6bl-spo11-2 3290367 N/A 3290369 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3290370 unspecified role unspecified role bait bait Region 155-733 Region 155-733 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false top6bl-spo11-3 3290368 N/A 3290369 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3290370 unspecified role unspecified role bait bait Region 155-733 Region 155-733 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false