DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ morgan-2016-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. DIP original experiment: DIP-269078X Science (New York, N.Y.) 2016 IMEx Structural basis for histone H2B deubiquitination by the SAGA DUB module. Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. Only protein-protein interactions imex curation morgan-2016-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. DIP original experiment: DIP-269079X Science (New York, N.Y.) 2016 IMEx Structural basis for histone H2B deubiquitination by the SAGA DUB module. Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. Only protein-protein interactions imex curation morgan-2016-3 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. DIP original experiment: DIP-269080X Science (New York, N.Y.) 2016 IMEx Structural basis for histone H2B deubiquitination by the SAGA DUB module. Morgan MT., Haj-Yahya M., Ringel AE., Bandi P., Brik A., Wolberger C. Only protein-protein interactions imex curation ubiq_yeast Ubiquitin UBI1 RPL40A YIL148W UBI2 RPL40B YKR094C UBI3 RPS31 YLR167W L9470.14 UBI4 SCD2 YLL039C protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG obsolete protein sgf73_yeast SAGA-associated factor 73 YGL066W SGF73 73 kDa SAGA-associated factor SAGA histone acetyltransferase complex 73 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSGDAEIKGIKPKVIEEYSLSQGSGPSNDSWKSLMSSAKDTPLQYDHMNRESLKKYFNPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGASGKSSTDPRDESTRETIRNGVESTGRNNNDDDNSNDNNNDDDDDDDNDDNEDDDDADDDDDNSNGANYKKNDSSFNPLKRSTSMESANTPNMDTKRSKTGTPQTFSSSIKKQKKVKQRNPTEKHLIDFNKQCGVELPEGGYCARSLTCKSHSMGAKRAVSGRSKPYDVLLADYHREHQTKIGAAAEKRAKQQELQKLQKQIQKEQKKHTQQQKQGQRSKQRNVNGGKSAKNGGKSTVHNGNNINEIGHVNLTPEEETTQVLNGVSRSFPLPLESTVLSSVRYRTKYFRMREMFASSFSVKPGYTSPGYGAIHSRVGCLDLDRTTDYKFRVRTPQPINHLTNQNLNPKQIQRLQQQRALQAQLLSQQQQQQQQQQQHHSPQAQAQASTQQPTQGMVPNHFPGGATNSSFNANVSSKQIQQQQQQQQHKSQDTGLTPLEIQSQQQKLRQQQLQQQKFEAAASYLANATKLMQESNQDSHLSGTHNNNSSKNGNNNLMTMKASISSPNTSVNSIQSPPSVNSVNGSGQGVSTGINVSGNNGRIEVGIGNSVNPYNGRIN 4618E2E47824321D sgf11_yeast SAGA-associated factor 11 SGF11 11 kDa SAGA-associated factor YPL047W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR 31CBBD4CAA18F3F9 sus1_yeast Transcription and mRNA export factor SUS1 SUS1 YBR111W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ DB0DA0C9DC13FB21 ubp8_yeast Ubiquitin carboxyl-terminal hydrolase 8 UBP8 YMR223W YM9959.05 Ubiquitin-specific-processing protease 8 Deubiquitinating enzyme 8 Ubiquitin thioesterase 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN BC632F12FBD0F73C h2b11_xenla Histone H2B 1.1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK h2a1_xenla Histone H2A type 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h32_xenla Histone H3.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h2a1_xenla-h2b11_xenla-1 3290013 N/A 3290016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290017 unspecified role unspecified role unspecified role unspecified role Region 1-104 Region 1-104 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3290018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290019 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290020 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290022 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290023 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290024 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false h2a1_xenla-h2b11_xenla-2 3290014 N/A 3290016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290017 unspecified role unspecified role unspecified role unspecified role Region 1-104 Region 1-104 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3290018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290019 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290020 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290022 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290023 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290024 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false h2a1_xenla-h2b11_xenla-3 3290015 N/A 3290016 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290017 unspecified role unspecified role unspecified role unspecified role Region 1-104 Region 1-104 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3290018 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290019 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290020 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290022 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290023 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3290024 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false