DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dawidowski-2016-1 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268434X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268421X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-3 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268430X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-4 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268426X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268422X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-6 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268431X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-7 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268427X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-8 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268423X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-9 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268432X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-10 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268428X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-11 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268424X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-12 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268433X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-13 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268429X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation dawidowski-2016-14 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Dawidowski D., Cafiso DS. DIP original experiment: DIP-268425X Structure (London, England : 1993) 2016 IMEx Munc18-1 and the Syntaxin-1 N Terminus Regulate Open-Closed States in a t-SNARE Complex. Dawidowski D., Cafiso DS. Only protein-protein interactions imex curation snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS snap25-stx1a-25 3289363 N/A 3289377 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stx1a-1 3289364 N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-26 3289365 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-31 3289366 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-32 3289367 N/A 3289377 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-33 3289368 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-34 3289369 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-35 3289370 N/A 3289377 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stx1a-stxbp1-20 3289371 N/A 3289379 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-36 3289372 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-37 3289373 N/A 3289377 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stx1a-stxbp1-21 3289374 N/A 3289379 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-38 3289375 N/A 3289377 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-39 3289376 N/A 3289377 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3289378 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false