DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ so-2016-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268845X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation so-2016-2 in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268842X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation so-2016-3 in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268843X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation so-2016-4 in vitro In vitro pull down pull down autoradiography autoradiography So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268847X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation so-2016-5 in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268846X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation so-2016-6 in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268844X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions imex curation smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN ru17_human U1 small nuclear ribonucleoprotein 70 kDa SNRNP70 RPU1 U1AP1 RNPU1Z SNRP70 protein protein human Homo sapiens Human MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV ruxf_human Small nuclear ribonucleoprotein F SNRPF PBSCF Sm protein F protein protein human Homo sapiens Human MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR rsmb_human Small nuclear ribonucleoprotein-associated proteins B and B' Sm protein B/B' SNRPB COD SNRPB1 protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP gemi2_human Gem-associated protein 2 GEMIN2 SIP1 Component of gems 2 Survival of motor neuron protein-interacting protein 1 protein protein human Homo sapiens Human MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS snrnp70-smn1-1 3288525 N/A 3288531 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288532 unspecified role unspecified role bait bait Region 90-194 Region 90-194 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false snrnp70-gemin2-1 3288526 N/A 3288533 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288534 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288535 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288536 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288537 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288538 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288539 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288540 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288532 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false snrnp70-gemin2-2 3288527 N/A 3288540 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288533 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288534 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288535 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288537 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288538 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288532 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false snrnp70-smn1-2 3288528 N/A 3288531 unspecified role unspecified role prey prey Region 189-294 Region 189-294 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3288532 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 90-194 Region 90-194 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 1-91 decreased the interaction rate/strength. Deletion of region 279-294 decreased the interaction rate/strength. snrnp70-smn1-3 3288529 N/A 3288531 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288532 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-194 Region 1-194 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snrnp70-snrpb-3 3288530 N/A 3288536 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288539 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3288532 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false