DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lechtenberg-2016-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. DIP original experiment: DIP-268575X Nature 2016 IMEx Structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation. Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. Only protein-protein interactions imex curation lechtenberg-2016-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. DIP original experiment: DIP-268577X Nature 2016 IMEx Structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation. Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. Only protein-protein interactions imex curation lechtenberg-2016-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. DIP original experiment: DIP-268576X Nature 2016 IMEx Structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation. Lechtenberg BC., Rajput A., Sanishvili R., Dobaczewska MK., Ware CF., Mace PD., Riedl SJ. Only protein-protein interactions imex curation ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM rnf31_human E3 ubiquitin-protein ligase RNF31 Zinc in-between-RING-finger ubiquitin-associated domain protein RNF31 ZIBRA HOIL-1-interacting protein RING finger protein 31 RING-type E3 ubiquitin transferase RNF31 protein protein human Homo sapiens Human MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTFCNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK rnf31-ube2d2-1 3288053 N/A 3288056 unspecified role unspecified role unspecified role unspecified role P62837:p.Cys85Lys C85K mutation mutation certain certain sequence position certain certain certain sequence position certain false K85-Ub K85-Ub ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3288057 unspecified role unspecified role unspecified role unspecified role Region 696-1072 Region 696-1072 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnf31-ube2d2-2 3288054 N/A 3288056 unspecified role unspecified role unspecified role unspecified role P62837:p.Cys85Lys C85K mutation mutation certain certain sequence position certain certain certain sequence position certain false K85-Ub K85-Ub ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3288057 unspecified role unspecified role unspecified role unspecified role Region 696-1072 Region 696-1072 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnf31-ube2d2-3 3288055 N/A 3288056 unspecified role unspecified role unspecified role unspecified role P62837:p.Cys85Lys C85K mutation mutation certain certain sequence position certain certain certain sequence position certain false K85-Ub K85-Ub ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3288057 unspecified role unspecified role unspecified role unspecified role Region 696-1072 Region 696-1072 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false