IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jones-2016-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk Oncotarget 2016 imex curation Only protein-protein interactions imex curation jones-2016-2 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk Oncotarget 2016 imex curation Only protein-protein interactions imex curation actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF k1c19_human Keratin, type I cytoskeletal 19 Cytokeratin-19 Keratin-19 KRT19 protein protein human Homo sapiens Human MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH k2c8_human Keratin, type II cytoskeletal 8 Keratin-8 KRT8 CYK8 Cytokeratin-8 Type-II keratin Kb8 protein protein human Homo sapiens Human MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK lirb3_human Leukocyte immunoglobulin-like receptor subfamily B member 3 LILRB3 ILT5 LIR3 CD85 antigen-like family member A Immunoglobulin-like transcript 5 Monocyte inhibitory receptor HL9 protein protein human Homo sapiens Human MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH fpps_human Farnesyl pyrophosphate synthase Farnesyl diphosphate synthase FDPS FPS KIAA1293 (2E,6E)-farnesyl diphosphate synthase Dimethylallyltranstransferase Geranyltranstransferase protein protein human Homo sapiens Human MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK 47ery-1 2963335 N/A 2963337 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 2963338 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 2963339 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 2963340 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 2963341 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false gln53leu variant variant certain certain sequence position certain certain certain sequence position certain false his61asp variant variant certain certain sequence position certain certain certain sequence position certain false leu69trp variant variant certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu90gln variant variant certain certain sequence position certain certain certain sequence position certain false met115leu variant variant certain certain sequence position certain certain certain sequence position certain false ala120phe variant variant certain certain sequence position certain certain certain sequence position certain false ser122asn variant variant certain certain sequence position certain certain certain sequence position certain false arg175gly variant variant certain certain sequence position certain certain certain sequence position certain false asn252asp variant variant certain certain sequence position certain certain certain sequence position certain false pro288arg variant variant certain certain sequence position certain certain certain sequence position certain false asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain false asn314asp variant variant certain certain sequence position certain certain certain sequence position certain false mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain false trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain false tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain false his409phe variant variant certain certain sequence position certain certain certain sequence position certain false val417met variant variant certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2963342 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells association association false false false 6B allele LILRB3*12 lilrb3-actb-2 2963335 N/A 2963337 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma N/A 2963338 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma N/A 2963339 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma N/A 2963340 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma N/A 2963341 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false gln53leu variant variant certain certain sequence position certain certain certain sequence position certain false his61asp variant variant certain certain sequence position certain certain certain sequence position certain false leu69trp variant variant certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu90gln variant variant certain certain sequence position certain certain certain sequence position certain false met115leu variant variant certain certain sequence position certain certain certain sequence position certain false ala120phe variant variant certain certain sequence position certain certain certain sequence position certain false ser122asn variant variant certain certain sequence position certain certain certain sequence position certain false arg175gly variant variant certain certain sequence position certain certain certain sequence position certain false asn252asp variant variant certain certain sequence position certain certain certain sequence position certain false pro288arg variant variant certain certain sequence position certain certain certain sequence position certain false asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain false asn314asp variant variant certain certain sequence position certain certain certain sequence position certain false mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain false trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain false tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain false his409phe variant variant certain certain sequence position certain certain certain sequence position certain false val417met variant variant certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2963342 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma association association false false false 6Bi allele LILRB3*12 lilrb3-actb-3 2963336 N/A 2963340 unspecified role unspecified role neutral component neutral component N/A 2963341 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false gln53leu variant variant certain certain sequence position certain certain certain sequence position certain false his61asp variant variant certain certain sequence position certain certain certain sequence position certain false leu69trp variant variant certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu90gln variant variant certain certain sequence position certain certain certain sequence position certain false met115leu variant variant certain certain sequence position certain certain certain sequence position certain false ala120phe variant variant certain certain sequence position certain certain certain sequence position certain false ser122asn variant variant certain certain sequence position certain certain certain sequence position certain false arg175gly variant variant certain certain sequence position certain certain certain sequence position certain false asn252asp variant variant certain certain sequence position certain certain certain sequence position certain false pro288arg variant variant certain certain sequence position certain certain certain sequence position certain false asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain false asn314asp variant variant certain certain sequence position certain certain certain sequence position certain false mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain false trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain false tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain false his409phe variant variant certain certain sequence position certain certain certain sequence position certain false val417met variant variant certain certain sequence position certain certain certain sequence position certain false association association false false false 7A allele LILRB3*12 krt8-lilrb3-1 2963336 N/A 2963339 unspecified role unspecified role neutral component neutral component N/A 2963341 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false gln53leu variant variant certain certain sequence position certain certain certain sequence position certain false his61asp variant variant certain certain sequence position certain certain certain sequence position certain false leu69trp variant variant certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu90gln variant variant certain certain sequence position certain certain certain sequence position certain false met115leu variant variant certain certain sequence position certain certain certain sequence position certain false ala120phe variant variant certain certain sequence position certain certain certain sequence position certain false ser122asn variant variant certain certain sequence position certain certain certain sequence position certain false arg175gly variant variant certain certain sequence position certain certain certain sequence position certain false asn252asp variant variant certain certain sequence position certain certain certain sequence position certain false pro288arg variant variant certain certain sequence position certain certain certain sequence position certain false asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain false asn314asp variant variant certain certain sequence position certain certain certain sequence position certain false mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain false trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain false tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain false his409phe variant variant certain certain sequence position certain certain certain sequence position certain false val417met variant variant certain certain sequence position certain certain certain sequence position certain false association association false false false 7Ai allele LILRB3*12 Binding of CK18 was much reduced in cytokeratin 8 knock-down cells.