DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lubman-2016-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268456X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation lubman-2016-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268460X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation lubman-2016-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268459X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation lubman-2016-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268457X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation lubman-2016-5 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268461X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation lubman-2016-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268458X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Lubman OY., Fremont DH. Only protein-protein interactions imex curation ccl3_mouse C-C motif chemokine 3 Ccl3 Mip1a Scya3 Heparin-binding chemotaxis protein L2G25B Macrophage inflammatory protein 1-alpha SIS-alpha Small-inducible cytokine A3 TY-5 protein protein mouse Mus musculus Mouse MKVSTTALAVLLCTMTLCNQVFSAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA e9m5r0_9gama RHVP-L.R17 RHVP.R17 protein protein cricetid gammaherpesvirus 2 Cricetid gammaherpesvirus 2 MANRSGMGGCMMLSLLIAGMSLMLGHCGPVGEPVASEINEASKVSSRLLTQDILFRKDRQATISLPIKLPVEDIITQTCDKITYGPLKFLDLLEKETAVLPLSTDITCPACLGRAVLVGKWECPAHVAVNESDLTVFGPNKEEHVPQFVTVQQPSDGKMQRLFFAKFLGTEESLAVLRVPGPDGHLCIQEALIHFKELSGAGVCSLWKANDSREEGLEMKQVDCLETTVLENQTCIATTLSKKIYHRLYCGERLMTGGQVSTRVLLTALGFYKRQPYTFHRVPKGMVYVHLIDSGSEDYMEYSECEEVTPGRYEDKQISYTFYTDLFQTADGEPVLASVWGTSGLKDSAYESCAFVIPTKGRRKLVPRRIMSKCYPFRLTYHPSTMTVRLDVRVEKHHGATDQGFVFLKMESGTYSEGREYYLDRVLWGEDSSTNNVLQ ccl2_mouse C-C motif chemokine 2 Ccl2 Je Mcp1 Scya2 Monocyte chemoattractant protein 1 Monocyte chemotactic protein 1 Platelet-derived growth factor-inducible protein JE Small-inducible cytokine A2 protein protein mouse Mus musculus Mouse MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN ccl3-e9m5r0_9gama-1 3286932 N/A 3286938 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false ccl3-e9m5r0_9gama-2 3286933 N/A 3286938 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false e9m5r0_9gama-ccl2-1 3286934 N/A 3286940 unspecified role unspecified role prey prey Region 24-148 Region 24-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P10148:p.Leu70Arg L70R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P10148:p.Lys71Asn K71N mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P10148:p.[Leu70Arg;Lys71Asn] L70R/K71N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction false false false e9m5r0_9gama-ccl3-1 3286935 N/A 3286938 unspecified role unspecified role prey prey Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction false false false ccl3-e9m5r0_9gama-3 3286936 N/A 3286938 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false e9m5r0_9gama-ccl2-2 3286937 N/A 3286940 unspecified role unspecified role prey prey Region 24-148 Region 24-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286939 unspecified role unspecified role bait bait E9M5R0:p.[Asp293_Ser294delinsAsnAla;Ser296_Glu297delinsAlaGln] D266N/S267A/S269A/E270Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false