DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ka-2016-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268455X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268449X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268450X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268453X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268451X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268454X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation ka-2016-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. DIP original experiment: DIP-268452X Structure (London, England : 1993) 2016 IMEx Crystal Structure of Streptococcus pyogenes Cas1 and Its Interaction with Csn2 in the Type II CRISPR-Cas System. Ka D., Lee H., Jung YD., Kim K., Seok C., Suh N., Bae E. Only protein-protein interactions imex curation csn2_strp1 CRISPR-associated protein Csn2 csn2 M5005_Spy0772 SPy_1049 protein protein strp1 Streptococcus pyogenes serotype M1 MNLNFSLLDEPIPLRGGTILVLEDVCVFSKIVQYCYQYEEDSELKFFDHKMKTIKESEIMLVTDILGFDVNSSTILKLIHADLESQFNEKPEVKSMIDKLVATITELIVFECLENELDLEYDEITILELIKSLGVKVETQSDTIFEKCLEILQIFKYLTKKKLLIFVNSGAFLTKDEVASLQEYISLTNLTVLFLEPRELYDFPQYILDEDYFLITKNMV q99zw1_strp1 CRISPR-associated endonuclease Cas1 cas1 SPy_1047 protein protein strp1 Streptococcus pyogenes serotype M1 MAGWRTVVVNTHSKLSYKNNHLIFKDAYKTELIHLSEIDILLLETTDIVLSTMLVKRLVDENVLVIFCDDKRLPTAMLMPFYGRHDSSLQLGKQMSWSETVKSQVWTTIIAQKILNQSCYLGACSYFEKSQSIMDLYHGLENFDPSNREGHAARIYFNTLFGNDFSRDLEHPINAGLDYGYTLLLSMFAREVVVSGCMTQFGLKHANQFNQFNFASDIMEPFRPLVDKIVYENRNQPFPKIKRELFTLFSDTFSYNGKEMYLTNIISDYTKKVVKALNNEGKGVPEFRI cas1-csn2-1 3286901 N/A 3286908 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3286909 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false cas1-3 3286902 N/A 3286909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas1-4 3286903 N/A 3286909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas1-csn2-2 3286904 N/A 3286908 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286909 unspecified role unspecified role unspecified role unspecified role Q99ZW1:p.Lys14Ala K14A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q99ZW1:p.Lys25Ala K25A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cas1-csn2-3 3286905 N/A 3286908 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csn2-1 3286906 N/A 3286908 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas1-csn2-4 3286907 N/A 3286908 unspecified role unspecified role unspecified role unspecified role Q99ZV9:p.Glu23Ala E23A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false