DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ saleh-2016-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. DIP original experiment: DIP-269003X Nature chemical biology 2016 IMEx Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. Only protein-protein interactions imex curation saleh-2016-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. DIP original experiment: DIP-269006X Nature chemical biology 2016 IMEx Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. Only protein-protein interactions imex curation saleh-2016-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. DIP original experiment: DIP-269004X Nature chemical biology 2016 IMEx Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. Only protein-protein interactions imex curation saleh-2016-4 human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. DIP original experiment: DIP-269005X Nature chemical biology 2016 IMEx Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. Only protein-protein interactions imex curation saleh-2016-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. DIP original experiment: DIP-269007X Nature chemical biology 2016 IMEx Cyclophilin A promotes cell migration via the Abl-Crk signaling pathway. Saleh T., Jankowski W., Sriram G., Rossi P., Shah S., Lee KB., Cruz LA., Rodriguez AJ., Birge RB., Kalodimos CG. Only protein-protein interactions imex curation p46108-1 Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS ppia_human Peptidyl-prolyl cis-trans isomerase A Cyclophilin A Cyclosporin A-binding protein PPIA CYPA Rotamase A protein protein human Homo sapiens Human MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC crk-ppia-1 3286804 N/A 3286809 unspecified role unspecified role unspecified role unspecified role P46108-1:p.Pro220Ala P220A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286810 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false crk-pxn-5 3286805 N/A 3286811 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286809 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false crk-ppia-2 3286806 N/A 3286809 unspecified role unspecified role unspecified role unspecified role Region 216-225 Region 216-225 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3286810 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ppia-crk-1 3286807 N/A 3286809 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3286810 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli proximity proximity close-contact colocalization neighbourhood interaction false false false crk-ppia-3 3286808 N/A 3286809 unspecified role unspecified role unspecified role unspecified role Region 216-225 Region 216-225 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P46108-1:p.Pro218Phe P218F mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3286810 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false