DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ abella-2016-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268921X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268927X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268923X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268935X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268925X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268938X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-7 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268933X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-8 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268931X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-9 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268929X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-10 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268928X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-11 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268934X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268922X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-13 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268936X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268924X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-15 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268939X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-16 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268937X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-17 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268926X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-18 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268932X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-19 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268930X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation abella-2016-20 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. DIP original experiment: DIP-268940X Nature cell biology 2016 IMEx Isoform diversity in the Arp2/3 complex determines actin filament dynamics. Abella JV., Galloni C., Pernier J., Barry DJ., Kjær S., Carlier MF., Way M. Only protein-protein interactions imex curation arp3_human Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 protein protein human Homo sapiens Human MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS arp2_human Actin-related protein 2 ACTR2 ARP2 Actin-like protein 2 protein protein human Homo sapiens Human MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR arpc4_human Actin-related protein 2/3 complex subunit 4 ARPC4 ARC20 Arp2/3 complex 20 kDa subunit protein protein human Homo sapiens Human MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF arpc3_human Actin-related protein 2/3 complex subunit 3 ARPC3 ARC21 Arp2/3 complex 21 kDa subunit protein protein human Homo sapiens Human MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ arpc2_human Actin-related protein 2/3 complex subunit 2 ARPC2 ARC34 PRO2446 Arp2/3 complex 34 kDa subunit protein protein human Homo sapiens Human MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR arp5l_human Actin-related protein 2/3 complex subunit 5-like protein Arp2/3 complex 16 kDa subunit 2 ARPC5L protein protein human Homo sapiens Human MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV arpc5_human Actin-related protein 2/3 complex subunit 5 ARPC5 ARC16 Arp2/3 complex 16 kDa subunit protein protein human Homo sapiens Human MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV arc1a_human Actin-related protein 2/3 complex subunit 1A ARPC1A SOP2L SOP2-like protein protein protein human Homo sapiens Human MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRIM arc1b_human Actin-related protein 2/3 complex subunit 1B Arp2/3 complex 41 kDa subunit p41-ARC ARPC1B ARC41 protein protein human Homo sapiens Human MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK cor1c_human Coronin-1C CORO1C CRNN4 Coronin-3 hCRNN4 CRN2 protein protein human Homo sapiens Human MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA cor1b_human Coronin-1B CORO1B Coronin-2 protein protein human Homo sapiens Human MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA arpc1a-actr2-1 3286615 N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286637 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286640 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286641 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286642 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false arpc1a-actr2-2 3286616 N/A 3286635 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false arpc5-actr2-1 3286617 N/A 3286643 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286637 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286641 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286642 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false actr2-actr3-13 3286618 N/A 3286643 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false arpc1a-actr3-1 3286619 N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286640 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286641 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286642 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false actr2-actr3-14 3286620 N/A 3286640 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286643 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false arpc1b-actr2-2 3286621 N/A 3286643 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false actr2-actr3-15 3286622 N/A 3286640 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false actr2-actr3-16 3286623 N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false actr2-actr3-17 3286624 N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false actr2-actr3-18 3286625 N/A 3286643 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286641 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false arpc1b-actr2-3 3286626 N/A 3286643 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286637 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286640 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286641 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false arpc1b-actr2-4 3286627 N/A 3286640 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286643 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false arpc5l-actr2-1 3286628 N/A 3286640 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286643 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286637 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286642 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false coro1b-coro1c-1 3286629 N/A 3286644 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286645 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false actr2-actr3-19 3286630 N/A 3286640 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286643 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false arpc1b-actr3-1 3286631 N/A 3286643 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3286635 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286639 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286640 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286641 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false actr2-actr3-20 3286632 N/A 3286640 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false arpc1a-actr2-3 3286633 N/A 3286640 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286635 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286636 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286637 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286638 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286639 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3286642 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false coro1c-coro1b-1 3286634 N/A 3286644 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3286645 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false