DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ helander-2015-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. DIP original experiment: DIP-267823X Structure (London, England : 1993) 2015 IMEx Pre-Anchoring of Pin1 to Unphosphorylated c-Myc in a Fuzzy Complex Regulates c-Myc Activity. Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. Only protein-protein interactions imex curation helander-2015-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. DIP original experiment: DIP-267825X Structure (London, England : 1993) 2015 IMEx Pre-Anchoring of Pin1 to Unphosphorylated c-Myc in a Fuzzy Complex Regulates c-Myc Activity. Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. Only protein-protein interactions imex curation helander-2015-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. DIP original experiment: DIP-267827X Structure (London, England : 1993) 2015 IMEx Pre-Anchoring of Pin1 to Unphosphorylated c-Myc in a Fuzzy Complex Regulates c-Myc Activity. Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. Only protein-protein interactions imex curation helander-2015-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. DIP original experiment: DIP-267824X Structure (London, England : 1993) 2015 IMEx Pre-Anchoring of Pin1 to Unphosphorylated c-Myc in a Fuzzy Complex Regulates c-Myc Activity. Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. Only protein-protein interactions imex curation helander-2015-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. DIP original experiment: DIP-267826X Structure (London, England : 1993) 2015 IMEx Pre-Anchoring of Pin1 to Unphosphorylated c-Myc in a Fuzzy Complex Regulates c-Myc Activity. Helander S., Montecchio M., Pilstål R., Su Y., Kuruvilla J., Elvén M., Ziauddin JM., Anandapadamanaban M., Cristobal S., Lundström P., Sears RC., Wallner B., Sunnerhagen M. Only protein-protein interactions imex curation myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE myc_mouse Myc proto-oncogene protein Proto-oncogene c-Myc Transcription factor p64 Myc protein protein mouse Mus musculus Mouse MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA myc-pin1-1 3286576 N/A 3286581 unspecified role unspecified role bait bait Region 1-88 Region 1-88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286582 unspecified role unspecified role prey prey Region 6-39 Region 6-39 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 50-163 Region 50-163 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false myc-pin1-2 3286577 N/A 3286581 unspecified role unspecified role unspecified role unspecified role Region 1-88 Region 1-88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286582 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myc-pin1-3 3286578 N/A 3286581 unspecified role unspecified role bait bait Region 1-88 Region 1-88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P01106:p.[Pro21Ala;Tyr22Ala;Phe23Ala;Tyr24Ala] P21A/Y22A/F23A/Y24A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P01106:p.[Pro21Ala;Tyr22Ala] P21A/Y22A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P01106:p.[Tyr22Ala;Phe23Ala] Y22A/F23A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286582 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false myc-pin1-4 3286579 N/A 3286581 unspecified role unspecified role unspecified role unspecified role Region 1-88 Region 1-88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286582 unspecified role unspecified role unspecified role unspecified role Region 6-39 Region 6-39 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 50-163 Region 50-163 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false myc-pin1-5 3286580 N/A 3286582 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286583 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P01108:p.[Tyr22Ala;Phe23Ala;Ile24Ala] Y22A/F23A/I24A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P01108:p.[Tyr22Ala;Phe23Ala] Y22A/F23A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P01108:p.[Pro21Ala;Tyr22Ala;Phe23Ala] P21A/Y22A/F23A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false