DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ battles-2016-1 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Battles MB., Langedijk JP., Furmanova-Hollenstein P., Chaiwatpongsakorn S., Costello HM., Kwanten L., Vranckx L., Vink P., Jaensch S., Jonckers TH., Koul A., Arnoult E., Peeples ME., Roymans D., McLellan JS. DIP original experiment: DIP-269002X Nature chemical biology 2016 IMEx Molecular mechanism of respiratory syncytial virus fusion inhibitors. Battles MB., Langedijk JP., Furmanova-Hollenstein P., Chaiwatpongsakorn S., Costello HM., Kwanten L., Vranckx L., Vink P., Jaensch S., Jonckers TH., Koul A., Arnoult E., Peeples ME., Roymans D., McLellan JS. Only protein-protein interactions imex curation fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN f-7 3286342 N/A 3286343 unspecified role unspecified role unspecified role unspecified role Region 1-513 Region 1-513 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false