DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stull-2016-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. DIP original experiment: DIP-268793X Nature structural & molecular biology 2016 IMEx Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. Only protein-protein interactions imex curation stull-2016-2 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. DIP original experiment: DIP-268794X Nature structural & molecular biology 2016 IMEx Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. Only protein-protein interactions imex curation imm7_ecolx Colicin-E7 immunity protein imm ceiE7 ImmE7 Microcin-E7 immunity protein protein protein ecolx Escherichia coli MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG spy_ecoli Periplasmic chaperone Spy Spheroplast protein Y JW1732 b1743 spy protein protein ecoli Escherichia coli (strain K12) MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE imm-spy-1 3286289 N/A 3286291 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286292 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false imm-spy-2 3286290 N/A 3286291 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3286292 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false