DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ evans-2016-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. DIP original experiment: DIP-268998X Nature chemical biology 2016 IMEx Mechanism of hydrogen activation by [NiFe] hydrogenases. Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. Only protein-protein interactions imex curation evans-2016-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. DIP original experiment: DIP-269000X Nature chemical biology 2016 IMEx Mechanism of hydrogen activation by [NiFe] hydrogenases. Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. Only protein-protein interactions imex curation evans-2016-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. DIP original experiment: DIP-268999X Nature chemical biology 2016 IMEx Mechanism of hydrogen activation by [NiFe] hydrogenases. Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. Only protein-protein interactions imex curation evans-2016-8 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. DIP original experiment: DIP-269001X Nature chemical biology 2016 IMEx Mechanism of hydrogen activation by [NiFe] hydrogenases. Evans RM., Brooke EJ., Wehlin SA., Nomerotskaia E., Sargent F., Carr SB., Phillips SE., Armstrong FA. Only protein-protein interactions imex curation mbhl_ecoli Hydrogenase-1 large chain Membrane-bound hydrogenase 1 large subunit NiFe hydrogenase hyaB b0973 JW0955 protein protein ecoli Escherichia coli (strain K12) MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTHVLGDDGSELISVQVR mbhs_ecoli Hydrogenase-1 small chain Membrane-bound hydrogenase 1 small subunit NiFe hydrogenase JW0954 b0972 hyaA protein protein ecoli Escherichia coli (strain K12) MNNEETFYQAMRRQGVTRRSFLKYCSLAATSLGLGAGMAPKIAWALENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHAVASAVDQRRRHNQQPTETEHQPGNEDKQA hyaa-hyab-3 3286262 N/A 3286266 unspecified role unspecified role prey prey Region 1-582 Region 1-582 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286267 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 46-311 Region 46-311 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false hyaa-hyab-4 3286263 N/A 3286266 unspecified role unspecified role unspecified role unspecified role Region 1-582 Region 1-582 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286267 unspecified role unspecified role unspecified role unspecified role Region 46-372 Region 46-372 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hyaa-hyab-5 3286264 N/A 3286266 unspecified role unspecified role unspecified role unspecified role Region 1-582 Region 1-582 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286267 unspecified role unspecified role unspecified role unspecified role Region 46-311 Region 46-311 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hyaa-hyab-6 3286265 N/A 3286266 unspecified role unspecified role unspecified role unspecified role Region 1-582 Region 1-582 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3286267 unspecified role unspecified role unspecified role unspecified role Region 46-311 Region 46-311 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false