DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ saxton-2016-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. DIP original experiment: DIP-269197X Science (New York, N.Y.) 2016 IMEx Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway. Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. Only protein-protein interactions imex curation saxton-2016-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. DIP original experiment: DIP-269194X Science (New York, N.Y.) 2016 IMEx Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway. Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. Only protein-protein interactions imex curation saxton-2016-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. DIP original experiment: DIP-269196X Science (New York, N.Y.) 2016 IMEx Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway. Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. Only protein-protein interactions imex curation saxton-2016-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. DIP original experiment: DIP-269195X Science (New York, N.Y.) 2016 IMEx Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway. Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. Only protein-protein interactions imex curation saxton-2016-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. DIP original experiment: DIP-269198X Science (New York, N.Y.) 2016 IMEx Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway. Saxton RA., Knockenhauer KE., Wolfson RL., Chantranupong L., Pacold ME., Wang T., Schwartz TU., Sabatini DM. Only protein-protein interactions imex curation mio_human GATOR complex protein MIOS MIOS Missing oocyte meiosis regulator homolog protein protein human Homo sapiens Human MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP wdr24_human GATOR complex protein WDR24 WDR24 C16orf21 WD repeat-containing protein 24 JFP7 protein protein human Homo sapiens Human MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS sesn2_human Sestrin-2 SESN2 SEST2 Hi95 Hypoxia-induced gene protein protein human Homo sapiens Human MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT wdr24-mios-5 3286005 N/A 3286010 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286011 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sesn2-mios-1 3286006 N/A 3286010 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286011 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286012 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false wdr24-mios-6 3286007 N/A 3286010 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286011 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286012 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false sesn2-mios-2 3286008 N/A 3286012 unspecified role unspecified role prey prey Region 338-480 Region 338-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286010 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286011 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3286012 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false wdr24-sesn2-3 3286009 N/A 3286011 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3286012 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P58004:p.[Asp406Ala;Asp407Ala] D406A/D407A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false