DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dale-2015-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. DIP original experiment: DIP-268160X Nature chemical biology 2015 IMEx A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. Only protein-protein interactions imex curation dale-2015-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. DIP original experiment: DIP-268161X Nature chemical biology 2015 IMEx A selective chemical probe for exploring the role of CDK8 and CDK19 in human disease. Dale T., Clarke PA., Esdar C., Waalboer D., Adeniji-Popoola O., Ortiz-Ruiz MJ., Mallinger A., Samant RS., Czodrowski P., Musil D., Schwarz D., Schneider K., Stubbs M., Ewan K., Fraser E., TePoele R., Court W., Box G., Valenti M., de Haven Brandon A., Gowan S., Rohdich F., Raynaud F., Schneider R., Poeschke O., Blaukat A., Workman P., Schiemann K., Eccles SA., Wienke D., Blagg J. Only protein-protein interactions imex curation ccnc_human Cyclin-C CCNC SRB11 homolog protein protein human Homo sapiens Human MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS cdk8_human Cyclin-dependent kinase 8 CDK8 Cell division protein kinase 8 Mediator of RNA polymerase II transcription subunit CDK8 Mediator complex subunit CDK8 Protein kinase K35 protein protein human Homo sapiens Human MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY ccnc-cdk8-5 3285303 N/A 3285305 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3285306 unspecified role unspecified role unspecified role unspecified role Region 1-403 Region 1-403 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ccnc-cdk8-6 3285304 N/A 3285305 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3285306 unspecified role unspecified role unspecified role unspecified role Region 1-403 Region 1-403 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false