DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tao-2015-1 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267184X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation tao-2015-2 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267187X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation tao-2015-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267185X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation tao-2015-4 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink tag fluorescence tag visualisation by fluorescence tag fluorescence Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267188X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation tao-2015-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-267186X Nature 2015 IMEx Structure of a eukaryotic SWEET transporter in a homotrimeric complex. Tao Y., Cheung LS., Li S., Eom JS., Chen LQ., Xu Y., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation swt2b_orysj Bidirectional sugar transporter SWEET2b SWEET2B OsJ_03146 P0047E11.3 P0454A11.22 Os01g0700100 LOC_Os01g50460 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MDSLYDISCFAAGLAGNIFALALFLSPVTTFKRILKAKSTERFDGLPYLFSLLNCLICLWYGLPWVADGRLLVATVNGIGAVFQLAYICLFIFYADSRKTRMKIIGLLVLVVCGFALVSHASVFFFDQPLRQQFVGAVSMASLISMFASPLAVMGVVIRSESVEFMPFYLSLSTFLMSASFALYGLLLRDFFIYFPNGLGLILGAMQLALYAYYSRKWRGQDSSAPLLLA swet1_arath Bidirectional sugar transporter SWEET1 SWEET1 Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 1 F24J8.9 At1g21460 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVNGKQDLQV sweet2b-1 3285153 N/A 3285158 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false sweet2b-2 3285154 N/A 3285158 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false sweet2b-sweet2b-1 3285155 N/A 3285158 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3285158 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sweet2b-3 3285156 N/A 3285158 unspecified role unspecified role unspecified role unspecified role Q5N8J1:p.[Met102Cys;Ile158Cys] M102C/I158C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false sweet1-sweet1-1 3285157 N/A 3285159 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3285159 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false