DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wolfson-2016-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269185X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269183X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269187X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269189X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269190X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269191X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269193X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269186X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269184X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-10 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269188X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation wolfson-2016-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269192X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions imex curation sesn2_human Sestrin-2 SESN2 SEST2 Hi95 Hypoxia-induced gene protein protein human Homo sapiens Human MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT wdr24_human GATOR complex protein WDR24 WDR24 C16orf21 WD repeat-containing protein 24 JFP7 protein protein human Homo sapiens Human MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS mio_human GATOR complex protein MIOS MIOS Missing oocyte meiosis regulator homolog protein protein human Homo sapiens Human MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP sesn1_human Sestrin-1 SESN1 PA26 SEST1 p53-regulated protein PA26 protein protein human Homo sapiens Human MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT sesn3_human Sestrin-3 SESN3 SEST3 protein protein human Homo sapiens Human MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT sesn_drome Sestrin homolog CG11299 Sesn protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYYAVDYYADMGQISQDCFAATQTGASDFDMDELDDLDQVTQVIGYHPQFHDHFLATQNFIMKGDGPLPNDYRYYLAIIAAARHQCPYLVKRYEKEFINQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHIERLTKGKNSWSLSEVVHAMVLLSHFHSLSSFVFSCGLTQKLDGLSSPKLKSPPAAVAALAPTILITPTSPTEPQKGKPVLAEISLNNANPDYDSQTAASSNGGAPPDSANAVADGPDATTLNGYLATAQQLPQQHGISVETLMERMKVLSQKQDECSEAELSSRFQKVEQQTAELAAVTPEAAVGVPTNLSHYVDDANFIYQDFARRGTESINTFRIQDYSWEDHGYSLVDGLYNDVGIFLDAKFRAAYNLTYCTMGGIKNVDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEARNQAELLYALREIMRYMT wdr24-sesn2-1 3284623 N/A 3284634 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false wdr24-mios-1 3284624 N/A 3284636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284634 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false wdr24-sesn2-2 3284625 N/A 3284634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false wdr24-mios-2 3284626 N/A 3284636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false wdr24-sesn1-1 3284627 N/A 3284637 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284634 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false wdr24-sesn3-1 3284628 N/A 3284638 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sesn-wdr24-1 3284629 N/A 3284639 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3284635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sesn2-wdr24-1 3284630 N/A 3284634 unspecified role unspecified role bait bait P58004:p.Ser190Trp S190W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3284635 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false wdr24-mios-3 3284631 N/A 3284636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false wdr24-mios-4 3284632 N/A 3284636 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284634 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3284635 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false sesn2-wdr24-2 3284633 N/A 3284634 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3284635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false