DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nguyen-2015-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. DIP original experiment: DIP-267315X Structure (London, England : 1993) 2015 IMEx Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly. Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. Only protein-protein interactions imex curation nguyen-2015-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. DIP original experiment: DIP-267318X Structure (London, England : 1993) 2015 IMEx Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly. Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. Only protein-protein interactions imex curation nguyen-2015-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. DIP original experiment: DIP-267316X Structure (London, England : 1993) 2015 IMEx Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly. Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. Only protein-protein interactions imex curation nguyen-2015-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. DIP original experiment: DIP-267317X Structure (London, England : 1993) 2015 IMEx Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly. Nguyen VS., Jobichen C., Tan KW., Tan YW., Chan SL., Ramesh K., Yuan Y., Hong Y., Seetharaman J., Leung KY., Sivaraman J., Mok YK. Only protein-protein interactions imex curation q6tlm0_aerhy aopB protein protein aerhy Aeromonas hydrophila MHSISSERPLSIGGMQPPLVEDSKGSSQATQVAAGDSHRHVEKHGQGVVLPQPMPGIGQQMSPPKQQELDQLRKTAQLGTANAAKLLGSSTLLNKLAFASPEEFEIELSKMTSELEQTQKKLKLADLERIRAENLKKIDENQTKMKEASEAADKAKKSGLASKIFGWISAIASMVIGAILIATGVGAAVGAMMIVGGAVGVANMAIQQAAADGRISPETMKVLGPIMIAAEILVAIVSIAVTFGASAASTAMKAVKFATQAADLVVDIGTGTAKAVDGGLQADAQIKQANLLENRQVMTELQGVMDKLKEVLSQMTESFQQVMEMIFQMITAKGAMLNSLASRPTAI q6tlm1_aerhy acrH protein protein aerhy Aeromonas hydrophila MEHDMTQVNEPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFRAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDMEHAFDKQ acrh-aopb-1 3284603 N/A 3284607 unspecified role unspecified role unspecified role unspecified role Region 40-264 Region 40-264 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3284608 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aopb-acrh-1 3284604 N/A 3284607 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3284608 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false acrh-aopb-2 3284605 N/A 3284607 unspecified role unspecified role unspecified role unspecified role Region 40-264 Region 40-264 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3284608 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false acrh-1 3284606 N/A 3284608 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false