IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sakowska-2015-1 yeast Saccharomyces cerevisiae Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Sakowska P., Jans DC., Mohanraj K., Riedel D., Jakobs S., Chacinska A. achacinska@iimcb.gov.pl Molecular and Cellular Biology 2015 imex curation Only protein-protein interactions imex curation sakowska-2015-2 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sakowska P., Jans DC., Mohanraj K., Riedel D., Jakobs S., Chacinska A. achacinska@iimcb.gov.pl Molecular and Cellular Biology 2015 imex curation Only protein-protein interactions imex curation erv1_yeast Mitochondrial FAD-linked sulfhydryl oxidase ERV1 Essential for respiration and vegetative growth protein 1 14 kDa regulatory protein ERV1 YGR029W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE mia40_yeast Mitochondrial intermembrane space import and assembly protein 40 YKL195W MIA40 TIM40 Mitochondrial import inner membrane translocase TIM40 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNLVVRNACRNRPSIQVARGLCRHQTRRLMASSPQFGRNSNQEKTAGFIMGILSMAGALYFIAPNRKPLFASRKVESDKTAEEELSSGGEQSPENEDDNNSKSDENGDDNDSKNDETEAGPQLGGDKIGASKVAEDGELVVLAEEDNKSSEDKDTDESKVSTKDDEQSNEDNATANNQKDENISSENSEENTSDKTLDNNAGSSEKKDPEHSDDEKSQQGQSDDKTTTEDNNGEEESSKKTVSDSENSAKQSESSDEEKEELRKQEEKQMGPTEEEVQHEGAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSDVKKEPLNEESKP 5904E8D0213D6EFA mic10_yeast MICOS complex subunit MIC10 MIC10 MCS10 MIO10 MOS1 Mitochondrial contact site complex 10 kDa subunit Mitochondrial inner membrane organization component of 10 kDa Mitochondrial organizing structure protein 1 YCL057C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV mint mic26_yeast MICOS subunit MIC26 MIC26 MCS29 MIO27 MOS2 Mitochondrial contact site complex 29 kDa subunit Mitochondrial inner membrane organization component of 27 kDa Mitochondrial organizing structure protein 2 G8575 YGR235C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKDFYRQLDPVEEKIVPPENAIVISSEAKEATVNEKEAKQGVLSQRVMKYIGENELVDGISVRDPDYLKRFFNERRKQFSAKWDKVTNKIDDIAGRYYAREESFTSTIASLHTDPNERLIPGLLSILVASMTGSVLARRRTWLLRATMPIILGSCCFAYAMPTTFRNTMGLIHNLEMNTFPHFTERQDRVWKETKRLSTASVQYYYDAKKWLNKDVEKTGNAIKNWTGVNVK D72E346FE810DF99 mic19_yeast MICOS complex subunit MIC19 MIC19 AIM13 Altered inheritance of mitochondria protein 13, mitochondrial MCS19 Mitochondrial contact site complex 19 kDa subunit YFR011C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSNTSKVGAGAEKQQVYTPLTQIDFSQSLVSQLDSSKESDYVTKQNAEKFIEKKVSQRLSNLEVETLKKFEDTLNNSLLSDDDKDAVDGISSSSLNNQIESLNKKLTLFDQLELQKLEKYGGAKGKSDKKTDNGSISIKAKLTECLLANKGKPLNCYEEMEEFKKLVMG 0E6670669D3AD0AA mic60_yeast MICOS complex subunit MIC60 MIC60 AIM28 Altered inheritance of mitochondria protein 28 FCJ1 FMP13 Formation of crista junctions protein 1 Found in mitochondrial proteome protein 13 Mitofilin YKR016W protein protein yeast Saccharomyces cerevisiae Baker's yeast MMLRTTASRKIVLRRGLASINTGTTVASKKASHKFRNTLWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDLLETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNIETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEALSNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKANEELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSSKILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGDCCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLLADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLNDAVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL mic12_yeast MICOS complex subunit MIC12 MIC12 AIM5 Altered inheritance of mitochondria protein 5, mitochondrial FMP51 Found in mitochondrial proteome protein 51 MCS12 Mitochondrial contact site complex 12 kDa subunit YBR1731 YBR262C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN mia40-erv1-1 3325600 N/A 3325602 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325603 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell c_terminus tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig6C mic60-mic19-mic26-mic10-1 3325600 N/A 3325604 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325605 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325606 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325607 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig8B mic60-mic10-1 3325600 N/A 3325604 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325608 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325605 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325606 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325607 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig9A mic60-mic19-1 3325600 N/A 3325606 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level P43594:p.Cys157Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P43594:p.Cys146Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3325607 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig9A Mic19-C146,157S behaved in a variable way. mic60-mic10-2 3325600 N/A 3325604 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325608 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325605 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325607 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig9A mia40-erv1-2 3325601 N/A 3325602 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell c_terminus tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3325603 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig6D