DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2015-19 in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267990X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-20 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267992X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-21 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267996X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-22 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267994X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-23 in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267991X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-24 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267995X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation chen-2015-25 in vitro In vitro pull down pull down autoradiography autoradiography Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. DIP original experiment: DIP-267993X Nature cell biology 2015 IMEx An interconnected hierarchical model of cell death regulation by the BCL-2 family. Chen HC., Kanai M., Inoue-Yamauchi A., Tu HC., Huang Y., Ren D., Kim H., Takeda S., Reyna DE., Chan PM., Ganesan YT., Liao CP., Gavathiotis E., Hsieh JJ., Cheng EH. Only protein-protein interactions imex curation bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK q07813-1 Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR bak1-bid-3 3283690 N/A 3283697 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3283698 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false bax-bid-2 3283691 N/A 3283699 unspecified role unspecified role bait bait Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3283697 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false bcl2-bax-8 3283692 N/A 3283700 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3283701 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false bcl2l1-bak1-4 3283693 N/A 3283701 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3283702 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3283703 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse association association false false false bak1-pmaip1-1 3283694 N/A 3283704 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3283698 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false mcl1-bak1-11 3283695 N/A 3283705 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3283701 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3283702 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false bax-pmaip1-1 3283696 N/A 3283704 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3283699 unspecified role unspecified role bait bait Region 1-171 Region 1-171 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false