DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stockbridge-2015-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stockbridge RB., Kolmakova-Partensky L., Shane T., Koide A., Koide S., Miller C., Newstead S. DIP original experiment: DIP-267150X Nature 2015 IMEx Crystal structures of a double-barrelled fluoride ion channel. Stockbridge RB., Kolmakova-Partensky L., Shane T., Koide A., Koide S., Miller C., Newstead S. Only protein-protein interactions imex curation stockbridge-2015-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stockbridge RB., Kolmakova-Partensky L., Shane T., Koide A., Koide S., Miller C., Newstead S. DIP original experiment: DIP-267151X Nature 2015 IMEx Crystal structures of a double-barrelled fluoride ion channel. Stockbridge RB., Kolmakova-Partensky L., Shane T., Koide A., Koide S., Miller C., Newstead S. Only protein-protein interactions imex curation crcb_borpe Putative fluoride ion transporter CrcB crcB BP1217 protein protein borpe Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) MLTYAPLNFIAIGIGATLGAWLRWVLGLRLNGAGWPWGTLTANLVGGYLIGVMVALIASHPEWPAWIRLAAVTGFLGGLTTFSTFSAETVDMLERGVYATAAAYAGASLAGSLAMTGLGLATVRLLLR b7li20_eco45 Putative fluoride ion transporter CrcB crcB ECS88_p0015 protein protein eco45 Escherichia coli O45:K1 (strain S88 / ExPEC) MIKSLFAVIIGGSVGCTLRWLLSTRFNSLFPNLPPGTLVVNLLAGLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTFSTFSVEVFALLQAGNYIWALTSVLVHVIGSLIMTALGFFIITILFA crcb-1 3283494 N/A 3283496 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false crcb-2 3283495 N/A 3283497 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false