DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ banci-2015-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. DIP original experiment: DIP-266445X Nature chemical biology 2015 IMEx N-terminal domains mediate [2Fe-2S] cluster transfer from glutaredoxin-3 to anamorsin. Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. Only protein-protein interactions imex curation banci-2015-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. DIP original experiment: DIP-266446X Nature chemical biology 2015 IMEx N-terminal domains mediate [2Fe-2S] cluster transfer from glutaredoxin-3 to anamorsin. Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. Only protein-protein interactions imex curation banci-2015-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. DIP original experiment: DIP-266447X Nature chemical biology 2015 IMEx N-terminal domains mediate [2Fe-2S] cluster transfer from glutaredoxin-3 to anamorsin. Banci L., Ciofi-Baffoni S., Gajda K., Muzzioli R., Peruzzini R., Winkelmann J. Only protein-protein interactions imex curation glrx3_human Glutaredoxin-3 GLRX3 Thioredoxin-like protein 2 PKC-interacting cousin of thioredoxin PKC-theta-interacting protein PICOT HUSSY-22 TXNL2 protein protein human Homo sapiens Human MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN q6fi81-1 Anamorsin CIAPIN1 Cytokine-induced apoptosis inhibitor 1 Fe-S cluster assembly protein DRE2 homolog CUA001 PRO0915 protein protein human Homo sapiens Human MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA glrx3-6 3282914 N/A 3282917 unspecified role unspecified role unspecified role unspecified role Region 130-335 Region 130-335 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ciapin1-glrx3-3 3282915 N/A 3282918 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3282917 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ciapin1-glrx3-11 3282916 N/A 3282918 unspecified role unspecified role unspecified role unspecified role Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3282917 unspecified role unspecified role unspecified role unspecified role Region 1-117 Region 1-117 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false