DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ qi-2015-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Qi S., Kim do J., Stjepanovic G., Hurley JH. DIP original experiment: DIP-267259X Structure (London, England : 1993) 2015 IMEx Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex. Qi S., Kim do J., Stjepanovic G., Hurley JH. Only protein-protein interactions imex curation qi-2015-5 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Qi S., Kim do J., Stjepanovic G., Hurley JH. DIP original experiment: DIP-267257X Structure (London, England : 1993) 2015 IMEx Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex. Qi S., Kim do J., Stjepanovic G., Hurley JH. Only protein-protein interactions imex curation qi-2015-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Qi S., Kim do J., Stjepanovic G., Hurley JH. DIP original experiment: DIP-267258X Structure (London, England : 1993) 2015 IMEx Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex. Qi S., Kim do J., Stjepanovic G., Hurley JH. Only protein-protein interactions imex curation qi-2015-7 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Qi S., Kim do J., Stjepanovic G., Hurley JH. DIP original experiment: DIP-267260X Structure (London, England : 1993) 2015 IMEx Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex. Qi S., Kim do J., Stjepanovic G., Hurley JH. Only protein-protein interactions imex curation atga1_human Autophagy-related protein 101 ATG101 C12orf44 PP894 protein protein human Homo sapiens Human MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ atg13-atg101-5 3282737 N/A 3282741 unspecified role unspecified role prey prey Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3282742 unspecified role unspecified role bait bait Region 12-200 Region 12-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GSt-tag GSt-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false atg101-atg13-7 3282738 N/A 3282741 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3282742 unspecified role unspecified role unspecified role unspecified role Region 12-200 Region 12-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false atg101-atg13-8 3282739 N/A 3282741 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3282742 unspecified role unspecified role unspecified role unspecified role Region 12-200 Region 12-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false atg101-atg13-9 3282740 N/A 3282741 unspecified role unspecified role unspecified role unspecified role Region 1-199 Region 1-199 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3282742 unspecified role unspecified role unspecified role unspecified role Region 12-200 Region 12-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false