DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ akera-2015-1 in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266468X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266462X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266466X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266465X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266470X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266463X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-7 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266467X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266469X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266464X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation akera-2015-10 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. DIP original experiment: DIP-266471X Nature cell biology 2015 IMEx Mad1 promotes chromosome congression by anchoring a kinesin motor to the kinetochore. Akera T., Goto Y., Sato M., Yamamoto M., Watanabe Y. Only protein-protein interactions imex curation cut7_schpo Kinesin-like protein cut7 cut7 Cell untimely torn protein 7 SPAC25G10.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPRVAPGGSQQFLGKQGLKAKNPVSTPNSHFRSASNPRKRREPPTIDTGYPDRSDTNSPTDHALHDENETNINVVVRVRGRTDQEVRDNSSLAVSTSGAMGAELAIQSDPSSMLVTKTYAFDKVFGPEADQLMLFENSVAPMLEQVLNGYNCTIFAYGQTGTGKTYTMSGDLSDSDGILSEGAGLIPRALYQLFSSLDNSNQEYAVKCSYYELYNEEIRDLLVSEELRKPARVFEDTSRRGNVVITGIEESYIKNAGDGLRLLREGSHRRQVAATKCNDLSSRSHSIFTITLHRKVSSGMTDETNSLTINNNSDDLLRASKLHMVDLAGSENIGRSGAENKRARETGMINQSLLTLGRVINALVEKAHHIPYRESKLTRLLQDSLGGKTKTSMIVTVSSTNTNLEETISTLEYAARAKSIRNKPQNNQLVFRKVLIKDLVLDIERLKNDLNATRKKNGVYLAESTYKELMDRVQNKDLLCQEQARKLEVLDLNVKSSREQLQYVSKSNQEHKKEVEALQLQLVNSSTELESVKSENEKLKNELVLEIEKRKKYETNEAKITTVATDLSQYYRESKEYIASLYEKLDRTERNNKENENNFWNLKFNLLTMLRSFHGSFTDETNGYFTLLNDFNASMEELLNTHSNQLLISMTKITEHFQSLDEALQSARSSCAVPNSSLDLIVSELKDSKNSLLDALEHSLQDISMSSQKLGNGISSELIELQKDMKESYRQLVQELRSLYNLQHTHEESQKELMYGVRNDIDALVKTCTTSLNDADIILSDYISDQKSKFESKQQDLIANIGKIVSNFLQEQNESLYTKADILHSHLNDTNSNIRKANEIMNNRSEEFLRNAASQAEIVGANKERIQKTVENGSQLLDSKSKAIHSNSRSMYDHCLALAESQKQGVNLEVQTLDRLLQKVKEHSEDNTKEKHQQLLDLLESLVGNNDNLIDSIKTPHTELQKITDHVLKGTTSLANHTNELLGLGDESLCNLETTIEDTSLVKLETTGDTPSKRELPATPSWTRDSSLIKETTNLNLDSDKKFVRETYTSSNQTNEPDVYDKPSNSSRTSLLRSSRSAYSKMKR 5669277875559D58 mad1_schpo Spindle assembly checkpoint component mad1 mad1 Mitotic arrest deficient protein 1 SPBC3D6.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSKLTVYQATTSMADSPRDPFQSRSQLPRFLATSVKKPNLKKPSVNSANETKNPKLASLEFQLENLKNDLKRKELEFEREQIELQRKLAEEHEQKNSLQLRLTLVEKQLEEQSTSYQKEIEEVRNEKEATQVKIHELLDAKWKEIAELKTQIEKNDQALSEKNHEVMVSNQALQMKDTNLTNLEKLFADSREQLETKCKELAAAEQQLQELSVHNQQLEESIKQVSSSIELEKINAEQRLQISELEKLKAAQEERIEKLSSNNRNVEILKEEKNDLESKLYRFEEYRDKVATLELENEKIQTELNSWKSLITNELPTPEAVSNKLVFLQNTNANLGERVSSLESQLSNKPANQPLGANEKDAAHITELETKLKELHEQNRRLQRQKSLATQEIDLLRENLKSYDDEEAILSEKNTDMKKLERIEGLVKLVDEYKLKLESMPVSLDVDETSDEVSLQKRRRKNEHKDAGYVTELYRKNQHLLFQVKEKTNIEAFLREQIITLESSIATLRQELAQVTEINSCRVLQHRSNPTLKYERIKAAQLEMLNAENSALKALLEDKKVDCLPIQSFKIAERKALDLKKEVAEREKRIQRLKEIFSVKSLEFREAVFSLFGYKLDFMPNGSVRVTSTYSREDNTAFIFDGESSTMKLVGNPSGPEFERLIRFWCDERKTIPGMLAALTLELLDKND 2D2A34114F108C3A mad2_schpo Mitotic spindle checkpoint component mad2 mad2 SPBC20F10.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSVPIRTNFSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRVNP DC9D1D213450C925 cenpe_human Centromere-associated protein E CENPE Kinesin-related protein CENPE Centromere protein E Kinesin-7 protein protein human Homo sapiens Human MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLKNLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDSQKLENIKMDLSYSLESIEDPKQMKQTLFDAETVALDAKRESAFLRSENLELKEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKLTSLIDGKVPKDLLCNLELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSEKDKLFSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEENERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRDSTLQTVEREKTLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNIDTQEQLRNALESLKQHQETINTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQDLEAKNTQTLTADVKDNEIIEQQRKIFSLIQEKNELQQMLESVIAEKEQLKTDLKENIEMTIENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCDRLAEVEEKLKEKSQQLQEKQQQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNENYEEVKSITKERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSEKTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDSTTLARIEMERLRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQESQSKQEQSLNMKEKDNETTKIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSVAKEKDDLQRLQEVLQSESDQLKENIKEIVAKHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQISEVQEKVNELKQFKEHRKAKDSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLKENTKEIVAKMKESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEEMRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKLRGIVSEKTNEISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQEKIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQSLTLSKLEIENLNLAQKLHENLEEMKSVMKERDNLRRVEETLKLERDQLKESLQETKARDLEIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKDLDKSKDELQKKIQELQKKELQLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHESLEEIRIVAKERDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRIKELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQRCSMEFHRIMKKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCDVPSRELRDLKLNQNMDLHIEEILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRIIAIMNESTEFEERSATISKEWEQDLKSLKEKNEKLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTTEKIRELENSLHEAKESAMHKESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTDPQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND cut7-1 3281923 N/A 3281933 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-850 Region 1-850 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1-cut7-1 3281924 N/A 3281933 unspecified role unspecified role prey prey Region 475-1085 Region 475-1085 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3281934 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mad1-mad2-7 3281925 N/A 3281935 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3281934 unspecified role unspecified role bait bait Region 59-689 Region 59-689 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P87169:p.[Arg523Ala;Val524Ala;Leu525Ala;Gln526Ala] R523A/V524A/L525A/Q526A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mad1-cut7-2 3281926 N/A 3281933 unspecified role unspecified role prey prey Region 475-1085 Region 475-1085 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3281934 unspecified role unspecified role bait bait Region 14-59 Region 14-59 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 31-40 Region 31-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P87169:p.[Lys37Ala;Lys38Ala] K37A/K38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 23-30 Region 23-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P87169:p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala] L28A/P29A/R30A/F31A/L32A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mad1l1-cenpe-1 3281927 N/A 3281936 unspecified role unspecified role prey prey Region 1958-2663 Region 1958-2663 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3281937 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y6D9:p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala] L17A/N18A/N19A/F20A/I21A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1-mad2-8 3281928 N/A 3281935 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3281934 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mad1-cut7-3 3281929 N/A 3281933 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3281934 unspecified role unspecified role bait bait Region 31-40 Region 31-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P87169:p.[Lys37Ala;Lys38Ala] K37A/K38A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P87169:p.[Leu28Ala;Pro29Ala;Arg30Ala;Phe31Ala;Leu32Ala] L28A/P29A/R30A/F31A/L32A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1l1-cenpe-2 3281930 N/A 3281936 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281938 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281937 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false mad1-mad1-1 3281931 N/A 3281934 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3281934 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cenpe-mad1l1-1 3281932 N/A 3281936 unspecified role unspecified role bait bait Region 1958-2663 Region 1958-2663 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3281937 unspecified role unspecified role prey prey Q9Y6D9:p.[Leu17Ala;Asn18Ala;Asn19Ala;Phe20Ala;Ile21Ala] L17A/N18A/N19A/F20A/I21A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false