DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jiang-2015-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. DIP original experiment: DIP-266457X Nature cell biology 2015 IMEx Local generation of fumarate promotes DNA repair through inhibition of histone H3 demethylation. Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. Only protein-protein interactions imex curation jiang-2015-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. DIP original experiment: DIP-266460X Nature cell biology 2015 IMEx Local generation of fumarate promotes DNA repair through inhibition of histone H3 demethylation. Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. Only protein-protein interactions imex curation jiang-2015-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. DIP original experiment: DIP-266458X Nature cell biology 2015 IMEx Local generation of fumarate promotes DNA repair through inhibition of histone H3 demethylation. Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. Only protein-protein interactions imex curation jiang-2015-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. DIP original experiment: DIP-266461X Nature cell biology 2015 IMEx Local generation of fumarate promotes DNA repair through inhibition of histone H3 demethylation. Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. Only protein-protein interactions imex curation jiang-2015-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. DIP original experiment: DIP-266459X Nature cell biology 2015 IMEx Local generation of fumarate promotes DNA repair through inhibition of histone H3 demethylation. Jiang Y., Qian X., Shen J., Wang Y., Li X., Liu R., Xia Y., Chen Q., Peng G., Lin SY., Lu Z. Only protein-protein interactions imex curation h2a1h_human Histone H2A type 1-H H2AC12 H2A-clustered histone 12 HIST1H2AH HIST1H2AI Histone H2A/s protein protein human Homo sapiens Human MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK h2az_human Histone H2A.Z H2AZ1 H2AFZ H2AZ protein protein human Homo sapiens Human MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h2b1b_human Histone H2B type 1-B H2BC3 H2B-clustered histone 3 H2BFF HIST1H2BB Histone H2B.1 Histone H2B.f protein protein human Homo sapiens Human MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK h2b1c_human Histone H2B type 1-C/E/F/G/I HIST1H2BG HIST1H2BI Histone H2B.1 A Histone H2B.a Histone H2B.g Histone H2B.h Histone H2B.k Histone H2B.l H2BC10 H2BC4 H2BC6 H2BC7 H2BC8 H2BFA H2BFG H2BFH H2BFK H2BFL HIST1H2BC HIST1H2BE HIST1H2BF protein protein human Homo sapiens Human MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK fumh_human Fumarate hydratase, mitochondrial FH protein protein human Homo sapiens Human MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK fh-h2afz-1 3281450 N/A 3281455 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281457 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281459 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281460 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281461 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false h2afz-fh-1 3281451 N/A 3281456 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3281461 unspecified role unspecified role prey prey P07954:p.Thr236Ala T236A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P07954:p.Thr236Asp T236D mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false fh-h2afz-2 3281452 N/A 3281456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281461 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P07954:p.Thr236Ala T236A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false h2afz-fh-2 3281453 N/A 3281456 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3281461 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false fh-h2afz-3 3281454 N/A 3281456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3281461 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false