DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ren-2015-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266279X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions imex curation ren-2015-4 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266280X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions imex curation ren-2015-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266281X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions imex curation ren-2015-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down anti tag western anti tag western blot anti tag western Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266282X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions imex curation insig_mycvp INSIG protein homolog Mvan_1475 protein protein mycvp Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) MRLRISEAVVLFLLGAVAALIGDHSHVVTGTTVYHTDAVPFVWSSPFWFPILVGAATASLAELRLHLPAPRDGVTARQALGGVAAVVGTYVTTALVHAFPVVPVTALVCAAAAITWCVLGDGPGAACGVVIAVIGPAVEIALVQLGVFAYHPDSDGLFGVAPFLAPLYFAFGVVAALLGELAVARRPQLGPPVCDTVSRGPGAG insi2_human Insulin-induced gene 2 protein INSIG2 protein protein human Homo sapiens Human MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE mint homomint scap_mouse Sterol regulatory element-binding protein cleavage-activating protein Scap Kiaa0199 protein protein mouse Mus musculus Mouse MTLTERLREKISQAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTPVKGYSPPPADSDHKQGEPSEQPEWYVGAPVAYIQQIFVKSSVSPWHRNLLAVDVFRSPLSRAFQLVEEIRNHVLRDSSGTKSLEEVCLQVTDLLPGLRKLRSLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRMVSYTITLVFQRYHAKFLSSLRARLMLLHPSPNCSLRAENLVHVHFKEEIGIAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNAATELGIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPESCLPSAKPVGRPARYERQQAVRPSTPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRTYLAAQVTEQSPLGEGSLGPMPVPSGVLPASHPDPAFSIFPPDAPKLPENQTLPGELPEHAGPAEGVHDSRAPEVTWGPEDEELWRKLSFRHWPTLFNYYNITLAKRYISLLPVIPVTLHLNPREALEGRHPQDGRSAWAPQEPLPAGLWESGPKGPGGTQTHGDITLYKVAALGLAAGIVLVLLLLCLYRVLCPRNYGQPGGGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLLVSCCLAGQVCVWDAQTGDCLTRIPRPGPRRDSCGGGAFETQENWERLSDGGKASPEEPGDSPPLRRRPRGPPPPSLFGDQPDLTCLIDTNFSVQLPPEPTQPEPRHRVGCGRSRDSGYDFSRLVQRVYQEEGLAAMRMPALRPPSPGPPLPQASQEEGTAPEKGSPPLAWTPSTAGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSNEEISSGITALVFLDRRIVAARLNGSLDFFSLETHTSLSPLQFRGTPGRGSSPSSSVYSSSNTVTCHRTHTVPCAHQKPITALRAAAGRLVTGSQDHTLRVFRLDDSCCLFTLKGHSGAITAVYIDQTMVLASGGQDGAICLWDVLTGSRVSQTFAHRGDVTSLTCTASCVISSGLDDFISIWDRSTGIKLYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD a1t557_mycvp-1 3280597 N/A 3280601 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false a1t557_mycvp-2 3280598 N/A 3280601 unspecified role unspecified role unspecified role unspecified role A1T557:p.Arg77Cys R77C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false a1t557_mycvp-3 3280599 N/A 3280601 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false insig2-scap-2 3280600 N/A 3280602 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y5U4:p.Phe115Ala F115A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Trp145Ala W145A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Asp149Ala D149A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Ala113Trp A113W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.His120Phe H120F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Gly117Phe G117F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Gln132Ala Q132A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Gly39Phe G39F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Cys77Asp C77D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Gly200Phe G200F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.Met203Trp M203W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9Y5U4:p.[Asn47Ala;Gln50Phe;Asn119Phe] N47A/Q50F/N119F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3280603 unspecified role unspecified role prey prey Region 1-741 Region 1-741 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false