IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ park-2015-13 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag fluorescence tag visualisation by fluorescence tag fluorescence Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu Oncotarget 2015 imex curation Only protein-protein interactions imex curation park-2015-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu human thymocytes (CD4+,CD8+) Oncotarget 2015 imex curation Only protein-protein interactions imex curation park-2015-12 human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu Oncotarget 2015 imex curation Only protein-protein interactions imex curation af1q_human Protein AF1q MLLT11 AF1Q protein protein human Homo sapiens Human MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL cd44_human_gene CD44_HUMAN_GENE gene gene human Homo sapiens Human lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI tcf7_human Transcription factor 7 TCF7 TCF1 T-cell-specific transcription factor 1 protein protein human Homo sapiens Human MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSSSSSPA mllt11-probe_human_cd44_promoter_region-1 3316303 N/A 3316306 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line N/A 3316307 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2F, Supp 3B probe_human_cd44_promoter_region-lef1-1 3316303 N/A 3316308 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line N/A 3316307 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2F probe_human_cd44_promoter_region-lef1-2 3316303 N/A 3316306 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep N/A 3316307 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3316308 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line physical association physical association false false false 2Fi mllt11-tcf7-2 3316304 N/A 3316309 unspecified role unspecified role prey prey N/A 3316306 unspecified role unspecified role bait bait physical association physical association false false false Supplementary Table S1 mllt11-tcf7-1 3316304 N/A 3316308 unspecified role unspecified role prey prey N/A 3316306 unspecified role unspecified role bait bait physical association physical association false false false Supplementary Table S1 mllt11-tcf7-3 3316305 N/A 3316309 unspecified role unspecified role prey prey N/A 3316306 unspecified role unspecified role bait bait physical association physical association false false false Figure 2A