DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2015-1 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Yang X., Wang S., Sheng Y., Zhang M., Zou W., Wu L., Kang L., Rizo J., Zhang R., Xu T., Ma C. DIP original experiment: DIP-266065X Nature structural & molecular biology 2015 IMEx Syntaxin opening by the MUN domain underlies the function of Munc13 in synaptic-vesicle priming. Yang X., Wang S., Sheng Y., Zhang M., Zou W., Wu L., Kang L., Rizo J., Zhang R., Xu T., Ma C. Only protein-protein interactions imex curation stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG p60880-2 Synaptosomal-associated protein 25 SNAP25 SNAP Super protein Synaptosomal-associated 25 kDa protein SNAP-25a protein protein human Homo sapiens Human MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG snap25-stx1a-24 3279213 N/A 3279214 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 2-253 Region 2-253 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false TMR-label TMR-label tetramethyl rhodamine label tetramethyl rhodamine label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3279215 unspecified role unspecified role fluorescence donor fluorescence donor Region 141-203 Region 141-203 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false BODIPY-label BODIPY-label bodipy label bodipy label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false