DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ falk-2015-1 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Falk SJ., Guo LY., Sekulic N., Smoak EM., Mani T., Logsdon GA., Gupta K., Jansen LE., Van Duyne GD., Vinogradov SA., Lampson MA., Black BE. DIP original experiment: DIP-266225X Science (New York, N.Y.) 2015 IMEx Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere. Falk SJ., Guo LY., Sekulic N., Smoak EM., Mani T., Logsdon GA., Gupta K., Jansen LE., Van Duyne GD., Vinogradov SA., Lampson MA., Black BE. Only protein-protein interactions imex curation falk-2015-2 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Falk SJ., Guo LY., Sekulic N., Smoak EM., Mani T., Logsdon GA., Gupta K., Jansen LE., Van Duyne GD., Vinogradov SA., Lampson MA., Black BE. DIP original experiment: DIP-266226X Science (New York, N.Y.) 2015 IMEx Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere. Falk SJ., Guo LY., Sekulic N., Smoak EM., Mani T., Logsdon GA., Gupta K., Jansen LE., Van Duyne GD., Vinogradov SA., Lampson MA., Black BE. Only protein-protein interactions imex curation h2b1c_human Histone H2B type 1-C/E/F/G/I HIST1H2BG HIST1H2BI Histone H2B.1 A Histone H2B.a Histone H2B.g Histone H2B.h Histone H2B.k Histone H2B.l H2BC10 H2BC4 H2BC6 H2BC7 H2BC8 H2BFA H2BFG H2BFH H2BFK H2BFL HIST1H2BC HIST1H2BE HIST1H2BF protein protein human Homo sapiens Human MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK hist1h2bc-1 3278632 N/A 3278634 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Rho-label Rho-label rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278634 unspecified role unspecified role fluorescence donor fluorescence donor Coumarin-label Coumarin-label coumarin label coumarin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false hist1h2bc-2 3278633 N/A 3278634 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Rho-label Rho-label rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278634 unspecified role unspecified role fluorescence donor fluorescence donor Coumarin-label Coumarin-label coumarin label coumarin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false