MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint michard-2015-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation michard-2015-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation michard-2015-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Michard C., Sperandio D., Baïlo N., Pizarro-Cerdá J., LeClaire L., Chadeau-Argaud E., Pombo-Grégoire I., Hervet E., Vianney A., Gilbert C., Faure M., Cossart P., Doublet P. weiguohu@fudan.edu.cn mBio 2015 Only protein-protein interactions imex curation imex curation arc1b_human Actin-related protein 2/3 complex subunit 1B Arp2/3 complex 41 kDa subunit p41-ARC ARPC1B ARC41 protein protein human Homo sapiens Human MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK q5ztm4_legph legK2 lpg2137 protein protein legph Legionella pneumophila subsp. pneumophila MVYYINLKEQPLHQDKEILTQLIKQYLLSGSSQSALFANHPYTLNDEDGNEIEFLLSHDIYKNQREDGITEFLILNGSQIGRGTKGVVIQSNHAMYLIDDELVIFPKENVLKVLYQNFINAEELIKQESVNYSILSGNSTAELVNLQGGNQGFFMQKEEGYALEELLEDIDSLQKLTFSDKMELAISFLTELENLHNKGYAHGDLTFKNILYNEKNNQLKIIDAGEMKVADERFWAQDISIAIEMISLLFTTNETNQFKASRYWSDEPTVRRIVNPNPVEAKLNRILNSEYRCVSDLKLAIERNYNEYLNNSNLVLKKNVELESEALGLQAYKNQMSKQQLLGEIQGFKENYWNMKDLLTLTNRHHLRVFLEYLDNICSAFKDDKTDEKSARAAYDFLNAQINKLFEDNSKNSKPSFESFSEDVQRFLIHIDTYLMKNPSACSNSIASTIQLLKQLDNKKSFNPEQSFKDFCSYKEITIQLLLKPFETPVAEMASAPAIASDLIEKQSDTKRKLQEMKSSANQDKQPIFTPSLMRGPS arp3_human Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 protein protein human Homo sapiens Human MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS actr3-arpc1b-1 3322742 N/A 3322745 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3322746 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1a legk2-actr3-1 3322742 N/A 3322747 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3322746 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1a actr3-arpc1b-2 3322743 N/A 3322747 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322746 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false f1c arpc1b-legk2-2 3322743 N/A 3322745 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322746 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false f1c arpc1b-legk2-1 3322744 N/A 3322745 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3322746 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false f1b