DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ andersen-2015-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265916X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-2 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265920X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265923X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-4 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265918X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-5 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265917X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265922X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-7 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265919X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation andersen-2015-8 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. DIP original experiment: DIP-265921X Nature 2015 IMEx The Drosophila TNF receptor Grindelwald couples loss of cell polarity and neoplastic growth. Andersen DS., Colombani J., Palmerini V., Chakrabandhu K., Boone E., Röthlisberger M., Toggweiler J., Basler K., Mapelli M., Hueber AO., Léopold P. Only protein-protein interactions imex curation q9w3i9_drome Traf6 Traf2 DTRAF2 Dmel\CG10961 EP325 TRAF TRAF2 TRAF6 dTRAF2 dTRAF6 dTraf2 dTraf6 dtraf2 traf2 Dmel_CG10961 CG10961 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQRVQADQKPARMHQHAHTHSHAHSLQHAEEKEHNSNEMTTNLSSTGRIAASSSATPSAAAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPEILAFHKPREAISTRGFGFLEYANISNIIQLGFCADDRLLIKIEINIV grnd_drome Protein grindelwald grnd CG10176 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSVRKLSALSLSIGGVPLIPSVSLVAAANGESRDCHGTICHPVNEFCYVATERCHPCIEVCNNQTHNYDAFLCAKECSAYKTFEPLKAEMLDIQNTQQLILLLLTILLVLIALRCAFQFLRWLIGNRCFQKLMRRLQSKAYPHPATANGKDLNATTIQNLNAINHPGSDLERAQSQIYSVAGAAEGSVVTMTTPVSTRYPAENSTTPTTVMTEIGYGYDNQAMVVTPVSEKPSAATIPVAF eiger_drome Protein eiger egr Darth CG12919 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTAETLKPFITPTSANDDGFPAKATSTATAQRRTRQLIPLVLGFIGLGLVVAILALTIWQTTRVSHLDKELKSLKRVVDNLQQRLGINYLDEFDEFQKEYENALIDYPKKVDGLTDEEDDDDGDGLDSIADDEDDDVSYSSVDDVGADYEDYTDMLNKLNNAHTGTTPTSETTAEGEGETDSASSASNDDNVFDDFTSYNAHKKKQERKSRSIADVRNEEQNIQGNHTELQEKSSNEATSKESPAPLHHRRRMHSRHRHLLVRKGESLLSARSEDSRPAAHFHLSSRRRHQGSMGYHGDMYIGNDNERNSYQGHFQTRDGVLTVTNTGLYYVYAQICYNNSHDQNGFIVFQGDTPFLQCLNTVPTNMPHKVHTCHTSGLIHLERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV q9vby7_drome Protein lin-7 homolog veli Lin7 D-veli DLin-7 DLin7 Dmel\CG7662 Dveli Flin-7 Lin-7 Veli d-Veli dLin-7 dLin7 dVeli lin-7 lin7 Dmel_CG7662 CG7662 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQRNTRRRQ grnd-traf6-1 3278124 N/A 3278132 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3278133 unspecified role unspecified role bait bait Q9VJ83:p.Glu202Ala E202A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9VJ83:p.[Pro200Ala;Glu202Ala] P200A/E202A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false grnd-egr-1 3278125 N/A 3278134 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3278133 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 125-241 Region 125-241 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false grnd-veli-1 3278126 N/A 3278135 unspecified role unspecified role prey prey Region 85-195 Region 85-195 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278133 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 125-168 Region 125-168 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false egr-grnd-1 3278127 N/A 3278134 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3278133 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 125-241 Region 125-241 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false grnd-traf6-2 3278128 N/A 3278132 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3278133 unspecified role unspecified role bait bait Q9VJ83:p.Glu202Ala E202A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 125-241 Region 125-241 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false grnd-veli-2 3278129 N/A 3278135 unspecified role unspecified role prey prey Region 85-195 Region 85-195 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3278133 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false egr-grnd-2 3278130 N/A 3278134 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 278-415 Region 278-415 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3278133 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false grnd-egr-2 3278131 N/A 3278134 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 278-415 Region 278-415 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3278133 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false