DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2015-19 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265997X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-20 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266000X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-21 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266002X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-24 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265999X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-25 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266001X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-26 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266003X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation liu-2015-27 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265998X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions imex curation flna_human Filamin-A FLNA FLN FLN1 Alpha-filamin Filamin-1 Endothelial actin-binding protein Actin-binding protein 280 Non-muscle filamin protein protein human Homo sapiens Human MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP itb3_human Integrin beta-3 Platelet membrane glycoprotein IIIa ITGB3 GP3A protein protein human Homo sapiens Human MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT p08514-1 Integrin alpha-IIb ITGA2B GP2B ITGAB GPalpha IIb Platelet membrane glycoprotein IIb protein protein human Homo sapiens Human MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE flna-itgb3-1 3277748 N/A 3277755 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1062-1154 Region 1062-1154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1350-1442 Region 1350-1442 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1861-1950 Region 1861-1950 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 2042-2131 Region 2042-2131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277756 unspecified role unspecified role unspecified role unspecified role Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false itga2b-flna-1 3277749 N/A 3277757 unspecified role unspecified role bait bait Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277755 unspecified role unspecified role prey prey Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false itgb3-itga2b-2 3277750 N/A 3277757 unspecified role unspecified role prey prey Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3277756 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false itgb3-flna-1 3277751 N/A 3277755 unspecified role unspecified role prey prey Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277756 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flna-itga2b-1 3277752 N/A 3277757 unspecified role unspecified role unspecified role unspecified role Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277755 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1062-1154 Region 1062-1154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1350-1442 Region 1350-1442 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1861-1950 Region 1861-1950 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 2042-2131 Region 2042-2131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false itgb3-itga2b-3 3277753 N/A 3277757 unspecified role unspecified role prey prey Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277756 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flna-itga2b-2 3277754 N/A 3277757 unspecified role unspecified role unspecified role unspecified role Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277755 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277756 unspecified role unspecified role unspecified role unspecified role Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false