DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bermdez_lpez-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264914X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264903X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264910X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264907X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-5 ecolx Escherichia coli atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264915X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264904X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264911X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264905X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264908X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264912X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264913X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264909X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation bermdez_lpez-2015-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. DIP original experiment: DIP-264906X PLoS biology 2015 IMEx ATPase-dependent control of the Mms21 SUMO ligase during DNA repair. Bermúdez-López M., Pociño-Merino I., Sánchez H., Bueno A., Guasch C., Almedawar S., Bru-Virgili S., Garí E., Wyman C., Reverter D., Colomina N., Torres-Rosell J. Only protein-protein interactions imex curation nse2_yeast E3 SUMO-protein ligase MMS21 MMS21 Methyl methanesulfonate-sensitivity protein 21 Non-structural maintenance of chromosome element 2 E3 SUMO-protein transferase MMS21 NSE2 YEL019C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALNDNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDKRSSQAIDVL F200378289B1CEE4 smc5_yeast Structural maintenance of chromosomes protein 5 SMC5 YOL034W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSLIDLGRYVERTHHGEDTEPRSKRVKIAKPDLSSFQPGSIIKIRLQDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITRIITRSKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRKSVESLRDFQNKKGEIELHSQLLPYVKVKDHKEKLNIYKEEYERAKANLRAILKDKKPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYRGRTKKLQATIISTKEDFLRSQEILAQTHLPEKSVFEDIDIKRKEIINKEGEIRDLISEIDAKANAINHEMRSIQRQAESKTKSLTTTDKIGILNQDQDLKEVRDAVLMVREHPEMKDKILEPPIMTVSAINAQFAAYLAQCVDYNTSKALTVVDSDSYKLFANPILDKFKVNLRELSSADTTPPVPAETVRDLGFEGYLSDFITGDKRVMKMLCQTSKIHTIPVSRRELTPAQIKKLITPRPNGKILFKRIIHGNRLVDIKQSAYGSKQVFPTDVSIKQTNFYQGSIMSNEQKIRIENEIINLKNEYNDRKSTLDALSNQKSGYRHELSELASKNDDINREAHQLNEIRKKYTMRKSTIETLREKLDQLKREARKDVSQKIKDIDDQIQQLLLKQRHLLSKMASSMKSLKNCQKELISTQILQFEAQNMDVSMNDVIGFFNEREADLKSQYEDKKKFVKEMRDTPEFQSWMREIRSYDQDTKEKLNKVAEKYEEEGNFNLSFVQDVLDKLESEIAMVNHDESAVTILDQVTAELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGSAGAVRLEKPKDYAEWKIEIMVKFRDNAPLKKLDSHTQSGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFLITPKLLTGLHYHEKMRIHCVMAGSWIPNPSEDPKMIHFGETSNYSFD 6752B96438CFB549 nse5_yeast Non-structural maintenance of chromosome element 5 YML023C NSE5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDGALINSVLYVSPRNGAHYFVELTEKHLLAFEMLNSMCLLENYDHVLLFLECQFGKSHNLAVIPFDIILVLFTLSTLSEYYKEPILRANDPYNTSRETLSRRALKLLQKYLAILKEFDSEQYNLYDLELLRCQFFLAIDTLTPKKQKWGFDRFRRTKSESGVTYRQNASVDPELDQAKTFKNPYRSYISCLEQRNTILGNRLLNLKLNEPGEFINMILWTLSNSLQESTPLFLSSHEIWMPLLEILIDLFSCRQDYFIQHEVAQNVSKSLFVQRLSESPLAVFFESLNTRNFANRFSEYVFLNCDYKLPSDNYATPVHPVYNGENTIVDTYIPTIKCSPLYKSQKSLALRRKLIGSCFKLLLRVPDGHRLITPRIVADDVIQGISRTLASFNDILQFKKFFMTENLSQESYFIPLLAEGTLSEILKDTQECVVILTLVENLSDGVSFCNEVIGLVKSKCFAFTEQCSQASYEEAVLNIEKCDVCLLVLLRYLLHLIGTEAILDAKEQLEMLHAIEKNDSGRRQWAKALNLGNDPPLLYPIVSQMFGVHDKSVIIE 6680A04D91E537DD smt3_yeast Ubiquitin-like protein SMT3 SMT3 D9719.15 YDR510W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY A2790DE7F315E1A7 nse4_yeast Non-structural maintenance of chromosome element 4 NSE4 YDL105W D2354 QRI2 Protein QRI2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSTVISRKRRNSTVTEPDSSGETRKQKKSRSDEKSSSSKDGDPQLEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVIGIKNNGLFAHDARAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRYMLKEHFKLNNIAENRNDLTLAADEQSAADQQEESDGDIDRTPDDNHTDKATSSFKATSMRHSYLQQFSHYNEFSQFNWFRIGALYNTISKNAPITDHLMGPLSIEKKPRVLTQRRRNNDQVGEKITAEKITQHSLNSTQQETTPEQVKKCFKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLMEHDEEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIKKYNITSPFLD 503FD4614C01CD51 smc1_yeast Structural maintenance of chromosomes protein 1 YFL008W SMC1 CHL10 DA-box protein SMC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFETQLKVVTRSKEAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGGSILEEKIAVLNNDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIETELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLDLSNYAE B504017AA0ECCA8C nse3_yeast Non-structural maintenance of chromosome element 3 NSE3 YDR288W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSIDNDSDVDLTEDLAVAKIVKENPVARKMVRYILSRGESQNSIITRNKLQSVIHEAAREENIAKPSFSKMFMDINAILYNVYGFELQGLPSKNNMNAGGNGSNSNTNKSMPEPLGHRAQKFILLNNVPHSKNFDDFKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLVYKGVLSVILCIVFFSKNNILHQELIKFLETFGIPSDGSKIAILNITIEDLIKSLEKREYIVRLEEKSDTDGEVISYRIGRRTQAELGLESLEKLVQEIMGLEKEQTKSLHDDIIKSIGDSYSI A750A9E31F80D8D1 mms21-smc5-1 3276983 N/A 3276996 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276997 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mms21-smc5-2 3276984 N/A 3276996 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role prey prey Q08204:p.[Ile780Arg;Ile784Arg;Phe787Ala;Asn791Ala] I780R/I784R/F787A/N791A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q08204:p.[Gln752Ala;Leu755Ala;Leu762Ala] Q752A/L755A/L762A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false smc5-nse5-4 3276985 N/A 3276998 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sumo-smc5-1 3276986 N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false mms21-smc5-3 3276987 N/A 3276996 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276997 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nse4-smc5-6 3276988 N/A 3277000 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sumo-nse4-1 3276989 N/A 3277000 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sumo-smc5-2 3276990 N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role prey prey Q08204:p.[Ile780Arg;Ile784Arg;Phe787Ala;Asn791Ala] I780R/I784R/F787A/N791A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q08204:p.[Gln752Ala;Leu755Ala;Leu762Ala] Q752A/L755A/L762A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q08204:p.[Met769Ala;Lys773Ala] M769A/K773A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false smc5-mms21-1 3276991 N/A 3276996 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sumo-smc1-1 3276992 N/A 3276997 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3277001 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sumo-nse4-2 3276993 N/A 3277000 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false smc5-nse3-7 3276994 N/A 3277002 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276997 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sumo-smc1-2 3276995 N/A 3277001 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276999 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Tag used for western blot detection. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false