DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bleichert-2015-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265454X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265455X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265457X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-4 trini Trichoplusia ni (Cabbage looper) Cabbage looper 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265456X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-5 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265464X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-6 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265460X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-7 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265461X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265462X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-9 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265463X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-10 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265459X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation bleichert-2015-11 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Bleichert F., Botchan MR., Berger JM. DIP original experiment: DIP-265458X Nature 2015 IMEx Crystal structure of the eukaryotic origin recognition complex. Bleichert F., Botchan MR., Berger JM. Only protein-protein interactions imex curation orc6_drome Origin recognition complex subunit 6 Orc6 CG1584 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHMDSQLLEA orc5_drome Origin recognition complex subunit 5 Orc5 CG7833 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEAICSSLEPLFPCREAAIETLGELIGDSSETYPSAIYLFGHSGTGKTALTRAFLKECGKRQNVRTAHLNAIECYTTKIMLEILLDSLAPDQGDALKVDNMLDFVEQLRRQAATRVEDQGFLIAVDNAERLRDMDANVLPVLLRLQELTNLNLCVILLSQLPFEKFYNKTGLSEIVCLHLAQYNKAETQRILGSDFQQVRNQLLEQFAQDKKRLEICQEAVTEDFYNNYLNLFLSVFYKACRDVPELQLTARKCLSTYLEPVLDGTVDATDISRLWRHIAGPLRSALTQIYMRIEKPAEEVEDFTAIEDQSVRKLAQSLELPYYAKFLLIAAFLASHNAAKQDKRLFVKHHGKQRKRMQTVNARAKTTEKMSTTLGPKSFSIDRLLAIFYAILEEKVGLTCNLLSQISTLVHLNLLSFVSGEQNIMEGSARLQCTIGLEFVLQIGKVVGFNVRQYLCDFM q9w102_drome Origin recognition complex subunit 4 Orc4 DmORC4 Dmel\CG2917 ORC ORC4 dmOrc4 orc4 rDmORC CG2917 Dmel_CG2917 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPEADRELVSIRRFLKERLQRDYTTLRGYAKERSNVRLLLQRTAEMGESNSLLLLGPRGSGKTTLINSVLADLLPNKSFGENTLIVHLDGNLHTDDRVALKSITVQMQLENAADGKVFGSFAENLAFLLQCLKAGGKHSKSVIFILEEFDLFCAHHNQTLLYNLFDVSQSAQAPICVLGVTCRLDVIELLEKRVKSRFSHRQVFLFPSLRRFEDYVDLCRDLLSLPTGNSLLLAAEKIYNLQNIQSGALYFSRNHFDPGEYGFSPRLRDAWNKQICKVLATQQARSTLQALHDFDISEAYLKNFLFRLVAHLRPQSPHITAEKMAAVGSQFEGDDKIELLCGLSVLELCLIIAIKHHSQIYDRDSFNFEIIYARFSKFAKVSTTMQAVERSIVLKAFEHLRIAELIMPLTGGAGGGVGKVQKEFEMHKLALTYSQIHHCMQRYQALPTEVAQWAQSSLI q7k2l1_drome Origin recognition complex subunit 3 Orc3 CG34315-RB lat lat-RA DmORC3 DmOrc3 Dmel\CG4088 LAT Lat ORC ORC3 l(2)49Fd l(2)vr6 latheo orc3 vr-6 vr6 CG4088 Dmel_CG4088 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDPTISVSKGCFVYKNGATRAGKKAASKRKRPAAESSSLLGKEVVQQPFYEEYRKAWNQINDHIADLQHRSYARTLEQLVDFVVGQAERDTPDEVLPTAALLTGINQPDHLSQFTALTQRLHAQRAAMVCVLQSRDCATLKAAVETLVFGLVEDNAEVEQMEDEDEDEDGAERDRKRLRRSQCTMKQLKSWYTNNFDSEQKRRQLVVILPDFECFNASVLQDLILILSAHCGSLPFVLVLGVATAMTAVHGTLPYHVSSKIRLRVFQTQAAPTGLNEVLDKVLLSPKYAFHLSGKTFKFLTHIFLYYDFSIHGFIQGFKYCLMEHFFGGNAFALCTDYSKALGRIKQLTHEDMETIRRLPSFRPYVEQINDCKRIIAVLTDDDYLKKKLPQLLRDCLLHFLLFRCSLEFLTELVGDLPRCPLGKLRRELYVNCLNRAIISTPEYKECLQMLSFLSKDEFVAKVNRALERTEQFLVEEIAPLELGEACTAVLRPKLEAIRLAVDEVVKATMATITTTSPNETRQATDHLTPVASRQELKDQLLQRSKEDKMRHQLNTPTTQFGRALQKTLQLIETQIVQDHLRALQDAPPIHELFVFSDIATVRRNIIGAPRAALHTALNNPHFYMQCKCCELQDQSLLVGTLPDLSVVYKLHLECGRMINLFDWLQAFRSVVSDSDHEEVAQEQIDPQIQARFTRAVAELQFLGYIKMSKRKTDHATRLTW orc2_drome Origin recognition complex subunit 2 Orc2 CG3041 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSASNKGGYKTPRKENLMSIENLTNSEEESEDLNTAMVGNAVESQPKVTSRRSTRRPSPTKKYQAYQKESNGKGQEERIVVNYVEMSDERSSDAEDQEEEESIEESENAARPAAKDLHLIQSEYNVAGTSMFGFNTPKKRDAMALAALNATPCTPKTPKTPRLGVKTPDTKRKKSMDQPKTPAHVRTRVKKQIAKIVADSDEDFSGDESDFRPSDEESSSSSSSSDAGNSSDNDAADDEPKTPSRARRAIVVPVLPKTPSAARLRQSARAKKSNEFVPESDGYFHSHASSKILTSDHTLDRLKNPRLAADRVFSLLSEIKTSAEHEGSINAIMEEYRSYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVNGFFPSLTIKDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETHLFLIVHNLDGAMLRNVKAQAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDCTTMLPYTNETAFENSLLVQNSGELALSSMRSVFSSLTTNSRGIYMLIVKYQLKNKGNATYQGMPFRDLYSSCREAFLVSSDLALRAQLTEFLDHKLVKSKRSVDGSEQLTIPIDGALLQQFLEEQEKK orc1_drome Origin recognition complex subunit 1 Orc1 CG10667 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVNKENARSVGQQVKWIGSQDELPPVKNLEHKNVYFYQKCIYGPLTLSVGDFILVSNADAAEPDTVSGCDVARILHMYELRELTDREPCRAIVQWYSWPKAIPHNKYDDDEVAIDFSLEVIEEHRPYDNDVALGAIYRKCIVLEGTSKTSAEEILKRHANKLKSTACPMFVSRYRFVKVKRSYRLIPLEIHLEQPEDNARPTRSSRKSLTAHRESKRSISARHDDTAGNKGSSVEKRRRASMAASSSVEFIDVNSFICENKVSPIKIVGGRSVVRLSEKKNAPEINANYLPASPLTEKNAKVETPKSRASAARRNLNLSLDRGADTTADSDCLNYSIVQQTPDPKTPSNDMKIKLRLSERRRSVRLASMDVDPLSLEEAVQEPNAQGRKRLGVANGDIYHTPTKKSKEPLESAAATEQTPSTRRKSILKSATSRLAEGTPRRSIHLSNIVEQRVFEDDEIISTPKRGRSKKTVQDNDEDYSPKKSVQKTPTRTRRSSTTTKTATTPSKGITTATATPMTPSQKMKKIRAGELSPSMQQRTDLPAKDSSKSELQLAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCGGCMYVSGVPGTGKTATVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVSWEQAHALLEKRFTTPAPRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMDLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSETFKGEAVQLVARKVAAVSGDARRALDICRRATEIADTAAVKCVTMLHVQQALAEMIASAKVQAIRNCSRMEQIFLQAIAAEVTRTGVEETTFMGVYQQVETIAAFMGVTFPPPGRALRLCSKLGAERLIISEHSRNDLFQKILLNVSADDIHYALRVEEMVN orc1-orc2-21 3276819 N/A 3276830 unspecified role unspecified role unspecified role unspecified role Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role unspecified role unspecified role Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role unspecified role unspecified role Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false orc1-orc2-22 3276820 N/A 3276830 unspecified role unspecified role unspecified role unspecified role Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role unspecified role unspecified role Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role unspecified role unspecified role Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false orc1-orc2-23 3276821 N/A 3276830 unspecified role unspecified role prey prey Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role prey prey Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role prey prey Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role bait bait Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false orc1-orc2-24 3276822 N/A 3276830 unspecified role unspecified role unspecified role unspecified role Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role unspecified role unspecified role Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role unspecified role unspecified role Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false orc3-1 3276823 N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false orc1-orc2-25 3276824 N/A 3276831 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role prey prey Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role prey prey Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role bait bait Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false orc4-orc1-7 3276825 N/A 3276831 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role prey prey Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role prey prey Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role prey prey Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false orc4-orc1-8 3276826 N/A 3276830 unspecified role unspecified role prey prey Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role prey prey Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role prey prey Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role prey prey Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false orc3-orc6-4 3276827 N/A 3276830 unspecified role unspecified role unspecified role unspecified role Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Y1B2:p.Ala236Cys A236C mutation mutation certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false orc1-orc2-26 3276828 N/A 3276831 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role unspecified role unspecified role Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role unspecified role unspecified role Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role unspecified role unspecified role Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false orc4-orc1-9 3276829 N/A 3276830 unspecified role unspecified role prey prey Region 187-257 Region 187-257 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276831 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276832 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276833 unspecified role unspecified role prey prey Region 47-721 Region 47-721 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276834 unspecified role unspecified role prey prey Region 266-618 Region 266-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3276835 unspecified role unspecified role prey prey Region 533-924 Region 533-924 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false