DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ burg-2015-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. DIP original experiment: DIP-265352X Science (New York, N.Y.) 2015 IMEx Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor. Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. Only protein-protein interactions imex curation burg-2015-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. DIP original experiment: DIP-265354X Science (New York, N.Y.) 2015 IMEx Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor. Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. Only protein-protein interactions imex curation burg-2015-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. DIP original experiment: DIP-265355X Science (New York, N.Y.) 2015 IMEx Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor. Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. Only protein-protein interactions imex curation burg-2015-5 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. DIP original experiment: DIP-265353X Science (New York, N.Y.) 2015 IMEx Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor. Burg JS., Ingram JR., Venkatakrishnan AJ., Jude KM., Dukkipati A., Feinberg EN., Angelini A., Waghray D., Dror RO., Ploegh HL., Garcia KC. Only protein-protein interactions imex curation x3cl1_human Fractalkine C-X3-C motif chemokine 1 CX3C membrane-anchored chemokine Neurotactin Small-inducible cytokine D1 A-152E5.2 CX3CL1 FKN NTT SCYD1 protein protein human Homo sapiens Human MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMFTYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV us28_hcmva G-protein coupled receptor homolog US28 US28 HHRF3 protein protein hcmva Human cytomegalovirus (strain AD169) (HHV-5) Human herpesvirus 5 HHV-5 MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP cx3cl1-us28-1 3276345 N/A 3276349 unspecified role unspecified role bait bait Region 25-101 Region 25-101 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3276350 unspecified role unspecified role prey prey Region 11-310 Region 11-310 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cx3cl1-us28-2 3276346 N/A 3276349 unspecified role unspecified role unspecified role unspecified role Region 25-101 Region 25-101 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3276350 unspecified role unspecified role unspecified role unspecified role Region 11-310 Region 11-310 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false cx3cl1-us28-3 3276347 N/A 3276349 unspecified role unspecified role unspecified role unspecified role Region 25-101 Region 25-101 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3276350 unspecified role unspecified role unspecified role unspecified role Region 11-310 Region 11-310 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false us28-cx3cl1-1 3276348 N/A 3276349 unspecified role unspecified role prey prey Region 25-101 Region 25-101 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3276350 unspecified role unspecified role bait bait Region 11-310 Region 11-310 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false