DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ magotti-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. DIP original experiment: DIP-264805X Structure (London, England : 1993) 2015 IMEx Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids. Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. Only protein-protein interactions imex curation magotti-2015-2 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. DIP original experiment: DIP-264806X Structure (London, England : 1993) 2015 IMEx Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids. Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. Only protein-protein interactions imex curation magotti-2015-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. DIP original experiment: DIP-264807X Structure (London, England : 1993) 2015 IMEx Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids. Magotti P., Bauer I., Igarashi M., Babagoli M., Marotta R., Piomelli D., Garau G. Only protein-protein interactions imex curation napep_human N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D NAPEPLD C7orf18 protein protein human Homo sapiens Human MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF napepld-1 3275393 N/A 3275396 unspecified role unspecified role unspecified role unspecified role Q6IQ20:p.[Gln158Ser;Tyr159Ser] Q158S/Y159S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 47-393 Region 47-393 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false napepld-2 3275394 N/A 3275396 unspecified role unspecified role unspecified role unspecified role Q6IQ20:p.[Gln158Ser;Tyr159Ser] Q158S/Y159S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 47-393 Region 47-393 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false napepld-3 3275395 N/A 3275396 unspecified role unspecified role unspecified role unspecified role Region 47-393 Region 47-393 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false