UniProt UniProt http://www.uniprot.org golan-2015-2 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Golan Y., Berman B., Assaraf YG. YFP fluorescence was determined using Confocal Microscopy. The species origin of the transfected constructs has been confirmed by the authors.Isoform specifications have not been communicated. assaraf@tx.technion.ac.il assaraf@technion.ac.il The Journal of biological chemistry 2015 imex curation Only protein-protein interactions golan-2015-1 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Golan Y., Berman B., Assaraf YG. YFP fluorescence intensity was determined using flow cytometry BiFC, transfection of tagged constructs as described in Ref. 22, Lasry et al 2014 (PMID 24451381) The species origin of the transfected constructs has been confirmed by the authors.Isoform specifications have not been communicated. assaraf@tx.technion.ac.il assaraf@technion.ac.il The Journal of biological chemistry 2015 imex curation Only protein-protein interactions golan-2015-4 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Golan Y., Berman B., Assaraf YG. The species origin of the transfected constructs has been confirmed by the authors.Isoform specifications have not been communicated. assaraf@tx.technion.ac.il assaraf@technion.ac.il The Journal of biological chemistry 2015 imex curation Only protein-protein interactions znt1_human Zinc transporter 1 SLC30A1 Solute carrier family 30 member 1 ZNT1 protein protein human Homo sapiens Human MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQIDIRNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPEFASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKPRRTKAENIPAVVIEIKNMPNKQPESSL znt4_human Zinc transporter 4 SLC30A4 ZNT4 Solute carrier family 30 member 4 protein protein human Homo sapiens Human MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVLYLLFMIGELVGGYIANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLEVLSAMISVLLVYILMGFLLYEAVQRTIHMNYEINGDIMLITAAVGVAVNVIMGFLLNQSGHRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPEYKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQSSSP znt2_human Zinc transporter 2 SLC30A2 Solute carrier family 30 member 2 ZNT2 protein protein human Homo sapiens Human MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD mint znt3_human Zinc transporter 3 SLC30A3 Solute carrier family 30 member 3 ZNT3 protein protein human Homo sapiens Human MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQA znt6_human Zinc transporter 6 SLC30A6 ZNT6 Solute carrier family 30 member 6 protein protein human Homo sapiens Human MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFDLFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP znt5_human Zinc transporter 5 SLC30A5 Solute carrier family 30 member 5 ZNT5 ZNTL1 ZTL1 ZnT-like transporter 1 UNQ863/PRO1879 protein protein human Homo sapiens Human MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFFVMILDFYVDSICSVKMEVSKCARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVVSAIFFILSANILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAFSHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPEYEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSDVLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYCKDGTYIM slc30a1-slc30a1-3 3312467 N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2i slc30a4-slc30a4-2 3312467 N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2l slc30a2-slc30a2-2 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Gly87arg mutation does not change localization to intracellular vesicles physical association physical association false false false 2b, 3j, 4f, 8A-f, slc30a3-slc30a3-2 3312467 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2c, 3k slc30a1-slc30a3-1 3312467 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3n slc30a1-slc30a2-2 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3m slc30a2-slc30a4-3 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3q and 8A-l slc30a1-slc30a4-2 3312467 N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3o slc30a3-slc30a4-4 3312467 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3r slc30a1-slc30a2-3 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8A-c slc30a1-slc30a2-4 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Q9BRI3:p.Gly87Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8B-c slc30a2-slc30a3-8 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3p, 8A-i slc30a2-slc30a3-9 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9BRI3:p.Gly87Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8B-i slc30a2-slc30a4-5 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9BRI3:p.Gly87Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8B-l slc30a2-slc30a3-5 3312467 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9BRI3:p.Gly87Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8Bf slc30a1-slc30a1-1 3312468 N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a2-slc30a2-1 3312468 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a3-slc30a3-1 3312468 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a4-slc30a4-1 3312468 N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a1-slc30a3-2 3312468 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a1-slc30a2-1 3312468 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a2-slc30a3-4 3312468 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a2-slc30a4-1 3312468 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a1-slc30a4-1 3312468 N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312470 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a2-slc30a4-2 3312468 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a3-slc30a4-3 3312468 N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312471 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a5-slc30a6-1 3312468 N/A 3312474 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3312475 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1A and B slc30a2-slc30a3-7 3312469 N/A 3312472 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3312473 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6A, B and C