DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ foos-2015-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264775X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions imex curation foos-2015-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264773X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions imex curation foos-2015-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264774X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions imex curation ubx_drome Homeotic protein ultrabithorax Ubx CG10388 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ exd_drome Homeobox protein extradenticle exd CG8933 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP exd-ubx-1 3274954 N/A 3274957 unspecified role unspecified role unspecified role unspecified role Region 233-367 Region 233-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274958 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false exd-ubx-2 3274955 N/A 3274957 unspecified role unspecified role unspecified role unspecified role Region 292-367 Region 292-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274958 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false exd-ubx-3 3274956 N/A 3274957 unspecified role unspecified role unspecified role unspecified role Region 292-367 Region 292-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274958 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false