DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pumroy-2015-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264758X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264756X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264762X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264760X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264764X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264765X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264759X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264757X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264761X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation pumroy-2015-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264763X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions imex curation ima3_human Importin subunit alpha-3 KPNA4 QIP1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein human Homo sapiens Human MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF pb2_i75a3 Polymerase basic protein 2 PB2 RNA-directed RNA polymerase subunit P3 protein protein i75a3 Influenza A virus (strain A/Victoria/3/1975 H3N2) MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPSLRMKWMMAMKYPITADKRITEMVPERNEQGQTLWSKMSDAGSDRVMVSPLAVTWWNRNGPVTSTVHYPKVYKTYFDKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDIDQSLIIAARNIVRRASVSADPLASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMSMRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETHGTERLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTILGKDAGTLIEDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN ima1_mouse Importin subunit alpha-1 Kpna2 Rch1 Importin alpha P1 Karyopherin subunit alpha-2 Pendulin Pore targeting complex 58 kDa subunit RAG cohort protein 1 SRP1-alpha protein protein mouse Mus musculus Mouse MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF ima7_human Importin subunit alpha-7 KPNA6 IPOA7 Karyopherin subunit alpha-6 protein protein human Homo sapiens Human METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL ima5_human Importin subunit alpha-5 KPNA1 RCH2 Karyopherin subunit alpha-1 SRP1-beta RAG cohort protein 2 Nucleoprotein interactor 1 protein protein human Homo sapiens Human MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL kpna4-pb2-1 3274689 N/A 3274699 unspecified role unspecified role unspecified role unspecified role Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna2-pb2-1 3274690 N/A 3274701 unspecified role unspecified role unspecified role unspecified role Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna2-pb2-2 3274691 N/A 3274701 unspecified role unspecified role bait bait Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role prey prey Region738-759 Region738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna6-pb2-1 3274692 N/A 3274702 unspecified role unspecified role unspecified role unspecified role Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna6-pb2-2 3274693 N/A 3274702 unspecified role unspecified role bait bait Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role prey prey Region 738-759 Region 738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false kpna1-pb2-4 3274694 N/A 3274703 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role prey prey Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false kpna4-pb2-2 3274695 N/A 3274699 unspecified role unspecified role unspecified role unspecified role Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna2-pb2-3 3274696 N/A 3274701 unspecified role unspecified role unspecified role unspecified role Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna6-pb2-3 3274697 N/A 3274702 unspecified role unspecified role unspecified role unspecified role Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kpna4-pb2-3 3274698 N/A 3274699 unspecified role unspecified role bait bait Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3274700 unspecified role unspecified role prey prey Region 738-759 Region 738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false