DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kjaer-2015-1 human Homo sapiens Human saxs x ray scattering saxs predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264750X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions imex curation kjaer-2015-2 human Homo sapiens Human comigration in sds comigration in sds page comigration in sds weight silver stain molecular weight estimation by silver staining weight silver stain Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264747X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions imex curation kjaer-2015-3 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264751X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions imex curation kjaer-2015-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264748X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions imex curation kjaer-2015-5 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264749X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions imex curation p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI masp1-7 3274298 N/A 3274303 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false mbl2-1 3274299 N/A 3274304 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false masp1-mbl2-1 3274300 N/A 3274303 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3274304 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false masp1-mbl2-2 3274301 N/A 3274303 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3274304 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false masp1-mbl2-3 3274302 N/A 3274303 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3274304 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false