DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2015-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265310X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-18 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265318X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265303X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-20 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265315X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-21 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265308X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-22 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265313X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-23 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265304X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-24 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265321X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-25 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265317X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-26 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265305X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-27 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265314X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-28 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265320X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-29 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265316X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-30 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265311X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-31 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265306X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-32 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265319X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-33 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265312X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-34 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265309X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-35 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265307X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation wang-2015-36 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265322X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions imex curation ltor1_human Ragulator complex protein LAMTOR1 LAMTOR1 PP7157 p27Kip1-releasing factor from RhoA C11orf59 Lipid raft adaptor protein p18 Protein associated with DRMs and endosomes PDRO Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 protein protein human Homo sapiens Human MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP rragc_human Ras-related GTP-binding protein C GTPase-interacting protein 2 TIB929 RRAGC protein protein human Homo sapiens Human MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI rraga_human Ras-related GTP-binding protein A Adenovirus E3 14.7 kDa-interacting protein 1 FIP-1 RRAGA protein protein human Homo sapiens Human MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR q8nbw4-1 Sodium-coupled neutral amino acid transporter 9 SLC38A9 URLC11 Solute carrier family 38 member 9 Up-regulated in lung cancer 11 protein protein human Homo sapiens Human MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM s38a9_human Sodium-coupled neutral amino acid transporter 9 URLC11 Up-regulated in lung cancer 11 SLC38A9 Solute carrier family 38 member 9 protein protein human Homo sapiens Human MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM rragb_human Ras-related GTP-binding protein B RRAGB protein protein human Homo sapiens Human MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR lamp1_human Lysosome-associated membrane glycoprotein 1 CD107 antigen-like family member A LAMP1 protein protein human Homo sapiens Human MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI ltor5_human Ragulator complex protein LAMTOR5 LAMTOR5 HBXIP Hepatitis B virus X-interacting protein Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 XIP protein protein human Homo sapiens Human MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS ltor4_human Ragulator complex protein LAMTOR4 LAMTOR4 C7orf59 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 protein protein human Homo sapiens Human MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV ltor2_human Ragulator complex protein LAMTOR2 LAMTOR2 MAPBPIP Late endosomal/lysosomal Mp1-interacting protein Roadblock domain-containing protein 3 Endosomal adaptor protein p14 HSPC003 ROBLD3 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2 Mitogen-activated protein-binding protein-interacting protein protein protein human Homo sapiens Human MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS q8nbw4-4 Sodium-coupled neutral amino acid transporter 9 Solute carrier family 38 member 9 URLC11 Up-regulated in lung cancer 11 SLC38A9 protein protein human Homo sapiens Human MNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM vatb2_human V-type proton ATPase subunit B, brain isoform ATP6V1B2 ATP6B2 VPP3 Endomembrane proton pump 58 kDa subunit HO57 Vacuolar proton pump subunit B 2 protein protein human Homo sapiens Human MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH va0d1_human V-type proton ATPase subunit d 1 Vacuolar proton pump subunit d 1 V-ATPase AC39 subunit V-ATPase 40 kDa accessory protein 32 kDa accessory protein ATP6V0D1 ATP6D VPATPD protein protein human Homo sapiens Human MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF rptor_human Regulatory-associated protein of mTOR p150 target of rapamycin (TOR)-scaffold protein RPTOR KIAA1303 RAPTOR protein protein human Homo sapiens Human MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR slc38a9-lamtor1-3 3273852 N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273875 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-119 Region 1-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false rragc-rraga-1 3273853 N/A 3273873 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false rragb-slc38a9-1 3273854 N/A 3273877 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lamtor2-lamp1-1 3273855 N/A 3273878 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273879 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273880 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273881 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false slc38a9-lamtor1-4 3273856 N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273881 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273875 unspecified role unspecified role bait bait Region 1-119 Region 1-119 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8NBW4-1:p.Leu74Ala L74A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8NBW4-1:p.Ile68Ala I68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8NBW4-1:p.Tyr71Ala Y71A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8NBW4-1:p.Pro85Ala P85A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q8NBW4-1:p.Pro90Ala P90A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 1-110 Region 1-110 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false slc38a9-atp6v0d1-1 3273857 N/A 3273882 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3273883 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273884 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false lamtor2-slc38a9-1 3273858 N/A 3273881 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false rragc-lamtor1-1 3273859 N/A 3273877 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273885 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273881 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false rraga-slc38a9-2 3273860 N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false lamtor1-slc38a9-1 3273861 N/A 3273872 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lamtor2-lamp1-2 3273862 N/A 3273878 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273879 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273880 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273881 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273875 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human association association false false false lamtor2-slc38a9-2 3273863 N/A 3273881 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lamtor1-rraga-1 3273864 N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false slc38a9-atp6v0d1-2 3273865 N/A 3273883 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273884 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273875 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human association association false false false lamtor4-slc38a9-1 3273866 N/A 3273880 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false lamtor1-slc38a9-2 3273867 N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false lamtor2-atp6v0d1-1 3273868 N/A 3273881 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273883 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273884 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273874 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false rragb-lamtor1-1 3273869 N/A 3273877 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273881 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false lamtor5-slc38a9-1 3273870 N/A 3273879 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false rragc-lamtor1-2 3273871 N/A 3273877 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3273876 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273872 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273881 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3273873 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false