IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ltoquart-2014-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Létoquart J., Huvelle E., Wacheul L., Bourgeois G., Zorbas C., Graille M., Heurgué-Hamard V., Lafontaine DL. denis.lafontaine@ulb.ac.be, marc.graille@polytechnique.edu, valerie.heurgue@ibpc.fr. Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation ltoquart-2014-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Létoquart J., Huvelle E., Wacheul L., Bourgeois G., Zorbas C., Graille M., Heurgué-Hamard V., Lafontaine DL. denis.lafontaine@ulb.ac.be, marc.graille@polytechnique.edu, valerie.heurgue@ibpc.fr. Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation ltoquart-2014-2 ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Létoquart J., Huvelle E., Wacheul L., Bourgeois G., Zorbas C., Graille M., Heurgué-Hamard V., Lafontaine DL. Abs were raised against the complex, then used to identify the two proteins when separated on SDS-PAGE. denis.lafontaine@ulb.ac.be, marc.graille@polytechnique.edu, valerie.heurgue@ibpc.fr. Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation tr112_yeast Multifunctional methyltransferase subunit TRM112 YNR046W N3445 TRM112 tRNA methyltransferase 112 eRF1 methyltransferase subunit TRM112 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV bud23_yeast 18S rRNA (guanine(1575)-N(7))-methyltransferase Bud site selection protein 23 YCR047C YCR47C BUD23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRPEELAPPEIFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLYAALKKGGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSGAPPQGEEQVNLDGVTMDEENVNLKKQLRQRLKGGKDKESAKSFILRKKELMKRRGRKVAKDSKFTGRKRRHRF A8011A097C461900 s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dhr1_yeast Probable ATP-dependent RNA helicase DHR1 ECM16 DHR1 YMR128W YM9553.04 DEAH box RNA helicase DHR1 Extracellular mutant protein 16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGTYRKRFNEKARSGHMAKLKELKRIRNKQFTRQDENDERVENPDSAPAESSTTEPNANAEILEPLTEEEKKMKKRKLQELFTPKESKVSRLKKKRLDKFIEHQLKREERKTIIGKLQDYKIDTSLLTSSKRLGEGRQTKKEEFKEALSLERQGRGNEQTNEILYEEYEPKVWDEYGEGGSSEDDDGEDDFEASFGSMPKPTDNEEKKSSGFIDHRPAKFGGSGLSFGFSNIKVINKESKTPKKKYNWRQRVEMEELKKHGKEDEMDFDTTSEDDDEEEDQEEEDKMHPSENPLEEVESADSETGSEKFDQNDVANEFKDWANQEIKKLEGRDQELVTPTLNIDYKPIIRKEDLDDGLQEAYVPINENSTRKAFYVEVSRSDEIQKARIQLPVFGEEHKIMEAIHHNDVVIICGETGSGKTTQVPQFLYEAGFGAEDSPDYPGMVGITQPRRVAAVSMAERVANELGDHGHKVGYQIRFDSTAKEDTKVKFMTDGVLLREMMHDFKLTKYSSIIIDEAHERNINTDILIGMLSRCVRLRAKLHKENPIEHKKLKLIIMSATLRVSDFSENKTLFPIAPPVLQVDARQFPVSIHFNRRTAFNYTDEAFRKTCKIHQKLPPGAILVFLTGQQEITHMVKRLRKEFPFKKNSKYNKDLETPVSKMGINSKTTDLEAEDIDFSVQVIDQDKFKSAIRYEEDEGNSGNGEDEEDEEEEGFEEVLTEGQTANDPLYVLPLYSLLPTKEQMRVFQKPPQGSRLCIVATNVAETSLTIPGVRYVVDSGRSKERKYNESNGVQSFEVGWVSKASANQRSGRAGRTGPGHCYRLYSSAVFEHDFEQFSKPEILRMPVESIVLQMKSMAIHNIINFPFPTPPDRVALSKAIQLLQYLGALDNKEMITEDGKKMSLFPLSPRFSKMLLVSDEKACLPYIVAIVSALSVGDPFINEFELGINEISRKPNPDENLDDKIREHDESTPGMDPELKKELRSKFYKSRSQFSKLDKFSDVFRLLSVVSAMDYVPKEQKEIFMKKNFLRGKLMEEIVKLRKQLMYIIKSNTSKENIAVVIRNEDLKSDIPSVIQIKLLKQMICAGFVDHVAVRADVLFPDDAKITNRTSIINIPYIPVLATRTPNIEDCFVYIHPTSILNNLGEMPPKYMLYYSLHLGGNNKTRMNTLCDIASTPLANIARKGLLLTYSKPLTGQGLKTVNLSPTERYCYVVPRFGSTVDNDLKIGWDLNPIAVHQKKQKGQWTVIKFITRKGFQTITGEEKEKK bud23-trm112-1 2959792 N/A 2959795 unspecified role unspecified role neutral component neutral component bud23 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2959796 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trm112 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2959804 2959801 direct interaction direct interaction false false false Supp Table 6 2A Rworking 0.191 Rfree 0.242 bud23-trm112-3 2959792 N/A 2959797 cofactor cofactor coenzyme neutral component neutral component N/A 2959795 unspecified role unspecified role neutral component neutral component bud23 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2959796 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trm112 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp Table 6 2.12A Rworking 0.178 Rfree 0.229 bud23-trm112-4 2959793 N/A 2959795 unspecified role unspecified role neutral component neutral component bud23 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2959796 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trm112 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3A bud23-ecm16-1 2959793 N/A 2959798 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2959795 unspecified role unspecified role neutral component neutral component bud23 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2959796 unspecified role unspecified role neutral component neutral component trm112 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3A bud23-trm112-2 2959794 N/A 2959795 unspecified role unspecified role prey prey bud23 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2959796 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trm112 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Supp Fig. 2B