DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ grallert-2015-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265279X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-2 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265266X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-3 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265273X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265288X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265287X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-6 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265280X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-7 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265296X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-8 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265274X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-9 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265267X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265286X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-11 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265297X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265275X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-13 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265281X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-14 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265294X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-15 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265268X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-16 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265295X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-17 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265289X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-18 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265269X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-19 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265283X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-20 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265300X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-21 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265291X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-22 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265276X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-23 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265282X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-24 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265270X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-25 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265277X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-26 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265290X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-27 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265285X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-28 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265293X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-29 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265271X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-30 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265298X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-31 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265284X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-32 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265292X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-33 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265272X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-34 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265278X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation grallert-2015-35 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. DIP original experiment: DIP-265299X Nature 2015 IMEx A PP1-PP2A phosphatase relay controls mitotic progression. Grallert A., Boke E., Hagting A., Hodgson B., Connolly Y., Griffiths JR., Smith DL., Pines J., Hagan IM. Only protein-protein interactions imex curation sds22_schpo Protein phosphatase 1 regulatory subunit SDS22 sds22 SPAC4A8.12c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNVSSEDGIAPETQLIIDDPDVQQIDADEDLLDDVPDDVDCVELIQSRIQSMASLGLERFKNLQSLCLRQNQIKKIESVPETLTELDLYDNLIVRIENLDNVKNLTYLDLSFNNIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRVIENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLACLSHCLRELYVSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDELSGLKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQIDATIIPKTSKQFP CF7FBAD984E2A345 pp11_schpo Serine/threonine-protein phosphatase PP1-1 dis2 bws1 SPBC776.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNPDVDLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMDQIQRIMRPTDVPDTGLLCDLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEKKQRYGYQGSSQNWHMTPPRKNKTGNSK 1106BB9C7D6FDCFB 2aba_schpo Protein phosphatase PP2A regulatory subunit B pab1 Protein phosphatase 2A 55 kDa regulatory subunit SPAC227.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNHSKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHINSISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNHLMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGSYSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMGSASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL 43B289222A2D8CC3 2ad1_schpo Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 1 isoform PP2A, B subunit, B' delta 1 isoform par1 pbp1 SPCC188.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKGIKSKMLSRGKSQDTQKSSKKKESKKSNSHDSSKAPKESPSTDPNGSVIGAQNDFLTVPKHSGKKVPIDTTPTPRDEILLENVRTVRKQRSSLYHISENRNLVRLPSFTDVPVNKWHSLALEKLEQCCVVFDFNDPSTDLYGKEVKREALQDLIDLISVRKEAIDESLYPSIVHMFAVNVFRPLPPPSNPPGEIMDLEEDEPALEVAWPHLHLVYDFFLRFFESPSLNTSVAKVYINQKFIRKLLVLFDSEDPRERDFLKTTLHRIYGKFLSLRAFIRRSINNLFLQFVYENEQFNGIAELLEILGSIINGFALPLKEEHKIFLSRVLIPLHKAKSLPLYYPQIAYGIVQFVEKDSSVTEEVVLGLLRYWPKVNSSKEVLFLNEIEDIIEVMEPSEFLKIQVPLFHKLATSISSQNFQVAERALYFFNNDYFVHLVEENVDIILPIIYPALFEISKSHWNRVIHSMVCNVLKLFMDINPSLFDEVDAEYSESRRKKEDEEIIREERWTILENIAKENAMKLKSQNPTTVHSTTERLKKLSLDYTNG A15FD882D516F88A pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK 2a5g_human Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform PPP2R5C KIAA0044 PP2A B subunit isoform B'-gamma PP2A B subunit isoform B56-gamma PP2A B subunit isoform PR61-gamma PP2A B subunit isoform R5-gamma Renal carcinoma antigen NY-REN-29 protein protein human Homo sapiens Human MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR pp1b_human Serine/threonine-protein phosphatase PP1-beta catalytic subunit PPP1CB protein protein human Homo sapiens Human MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR 2aaa_schpo Protein phosphatase PP2A regulatory subunit A paa1 Protein phosphatase 2A 65 kDa regulatory subunit SPAP8A3.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQTENQVNDLYPIAVLIDELKHDEITYRLNALERLSTIALALGPERTRDELIPFLDESIDDEDEVLSALADQLGNFVDYVGGPEYAHVLLSPLENLAATEETVVRDKAVDSLNKVCICLSQEQLEQYFVPLVQRLSTAEWFTSRASSAGLYCAAYSQSENPAVKVSLRQSFSHLCHDEAPMVRRPAATNCAKFVFLVTKQEAIDEFIPLFNSLSNDDQDSVRLLSFDIMVSLAEVLKSDSEIRHYLLQPLRSFVSDSSWRTRYMVAANFVKLAKVVGPSLIKDELIKPFVLLMKDTEQEVRRAIATQIPGFCELLDKRIVLEEIIPVIQELINDPAQHVRAALGMNIGALAPQLGKEKTTEYLLPMFLELLKDENPEVRLNIISKLEVVNKVVGIELLSQSLLPAIVTLAEDKQWRVRLAIIDYIPLLAQQLGVEFFNEKMGNLCMSWLEDHVYSIREAAIKNLRKLTEIFGLEWATETIIPKFLAMRSHPNYLYRMTTIFAISEIAPALNAEVIEKQILPTLEQLVNDPIPNIRFNVAKAFEVLKPVLAAGGDSTVYEQQIIPLLEQLTKDNDPDVQYFATQALEQTND 7F6337739B98CDC3 pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK cut12_schpo Spindle pole body-associated protein cut12 cut12 stf1 SPBC649.05 Cell untimely torn protein 12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSETLNTPPTYAWVLKAFSSKLAGTVTKPVTKMSSYIEDAESDAELPQDAKEDLRPTETLTPLKSKAAQNGILKTPGTLQIKKTVNFKDISKDAATWNRPTKNNFLFTRLDDENPLMGHEEFKSPLLQSTPKPNINNPDNENKSKHDEFDNRYNININESYKNETKSNQRLGEDVPSKKKYPHSMDAEISKFKWDSNNNNDWSSLMKDCFRDVVNNNRKMKEIIKDVMIDTSQAFPSESLDEPDYTINLDAPRSSSGKYWKQKFSMLDSAHSDLELELTSIRERLESLILEKQEEINFWKQRCRALETEKIHNHQGQQSKYKGKEFVGNRFSQMRELYTAKPSPITTKVVSRPSQSDVREPQEQVPSKNLHRGADMSHLAAQMLTHSSKKSHTTNLIPSEGIISSTPISAASKVRMNLMQSNQTPTPAPFSIAAKKSHLPSKLSFPQDGGSLSSATTLQQLPKARVTPNVLSSLSSNLGKTNPTSVYQSKANVTTSADVEKPQVKVATSSRVDYDLKSPNQRTANAKKRLEERRRRRKLKLQELQLNS 01FF6BC68D577A54 pp2a2_schpo Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit ppa2 SPBC16H5.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSIDPANDSKLAPEANDATLGDVDRWIEQLKKCEPLSEADVEMLCDKAREVLCQENNVQPVRNPVTVCGDIHGQFHDLMELFKIGGDVPDMNYLFMGDYVDRGYHSVETVSLLVAMKLRYPNRITILRGNHESRQITQVYGFYDECLRKYGSANVWKHFTNLFDYFPLTALIEDRIFCLHGGLSPSIDSLDHVRTLDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISETFNHANGLSLTARAHQLVMEGFNWAHDGDVVTIFSAPNYCYRCGNQAAILEVDDTMNQVFLQFDPAPREGEPVIARRTPDYFL 8709C544FAFEDD85 ptpa2_schpo Serine/threonine-protein phosphatase 2A activator 2 rrd2 Peptidyl-prolyl cis-trans isomerase PTPA-2 Phosphotyrosyl phosphatase activator 2 SPAC1782.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLSREEQNRCFVPVRRILDNEDLKLFKEGDAYKLIDSFICDLDEAVKDKPISASIPQSSSIEHVLNILDRVGEIKQENPAIDNMGSRFGNPAFQSFYDQVYIETPKLHQVFGIEHNAAMEAGRYFYESFGNRKRIDYGSGHELYFMSWLLILKQLGIFTKNDYPALVVRVFVKYVELMRSLQIFYTLEPAGSHGVWGLDDFHFLPFLFGAAQLVNHKYLRPKHVRDPEILEMCRADYMYLGYVYFLNKLKPSVSLRFHSPMIDDISAVKTWSKVNEGMIKMYRAEVLGKLPIMQHYLFGHLIPASPGMSPAPQDGDDSEVTHVHSHYADCCGIKIPSAISAAKNNGSRIPFD F88B7B260B3DCB90 pp2a1_schpo Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit ppa1 SPAC823.15 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSVSGKIGEVDRWIEQLSRCEPLSEEDVIQMCDLAKEVLSVESNVQSVRCPVTVCGDIHGQFHDLMELFNIGGPSPDTNYLFMGDYVDRGYHSVETVSLLIAFKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWQYFTDLFDYLPLTALIEDRIFCLHGGLSPSIDTLDHVRILDRVQEVPHEGPICDLLWSDPDDRPGWGISPRGAGYTFGPDIAEAFNHNNGLDLIARAHQLVMEGYNWTTNHNVVTIFSAPNYCYRCGNQAAIMGIDDHINYAFIQYDTAPRKEELHVTRRTPDYFL 0F47604E5F740B0C dis2-sds22-1 3272597 N/A 3272632 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false pab1-dis2-1 3272598 N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12702:p.Val54Ala V54A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12702:p.[Arg52Ala;Val54Ala;Phe56Ala] R52A/V54A/F56A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-dis2-1 3272599 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false ppp2r5c-ppp1cc-1 3272600 N/A 3272636 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3272637 unspecified role unspecified role bait bait Q13362:p.[Leu289Ala;Leu290Ala;Val302Ala;Phe304Ala] L289A/L290A/V302A/F304A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ppp2r5c-ppp1cb-1 3272601 N/A 3272638 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3272637 unspecified role unspecified role bait bait Q13362:p.[Leu289Ala;Leu290Ala;Val302Ala;Phe304Ala] L289A/L290A/V302A/F304A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pab1-dis2-2 3272602 N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false paa1-dis2-1 3272603 N/A 3272639 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false dis2-par1-1 3272604 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-dis2-2 3272605 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q10428:p.Gly367Ala G367A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q10428:p.Gly367Val G367V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Lys379Ala;Val381Ala;Phe383Ala] K379A/V381A/F383A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Ala;Lys379Ala;Val381Ala;Phe383Ala] G367A/K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Val;Lys379Ala;Val381Ala;Phe383Ala] G367V/K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.Ser378Asp S378D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Ala;Val381Ala] G367A/V381A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Val;Val381Ala] G367V/V381A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false ppp2r5c-ppp1ca-1 3272606 N/A 3272640 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3272637 unspecified role unspecified role bait bait Q13362:p.[Leu289Ala;Leu290Ala;Val302Ala;Phe304Ala] L289A/L290A/V302A/F304A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false paa1-pab1-1 3272607 N/A 3272639 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-dis2-3 3272608 N/A 3272635 unspecified role unspecified role bait bait Region 112-424 Region 112-424 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q10428:p.Gly367Val G367V mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q10428:p.Gly367Ala G367A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Lys379Ala;Val381Ala;Phe383Ala] K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Val;Lys379Ala;Val381Ala;Phe383Ala] G367V/K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Ala;Val381Ala] G367A/V381A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3272633 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dis2-paa1-1 3272609 N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false dis2-paa1-2 3272610 N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-dis2-4 3272611 N/A 3272635 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-paa1-3 3272612 N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false pab1-dis2-3 3272613 N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false dis2-pab1-1 3272614 N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12702:p.Val54Ala V54A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12702:p.[Arg52Ala;Val54Ala;Phe56Ala] R52A/V54A/F56A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-dis2-5 3272615 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false paa1-dis2-2 3272616 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false par1-dis2-6 3272617 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false dis2-cut12-1 3272618 N/A 3272641 unspecified role unspecified role prey prey O59755:p.Gly71Val G71V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O59755:p.[Val85Ala;Phe87Ala] V85A/F87A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O59755:p.[Ile72Leu;Lys74Arg;Val85Ala;Phe87Ala] I72L/K74R/V85A/F87A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O59755:p.[Gly71Val;Lys83Ala;Val85Ala;Phe87Ala] G71V/K83A/V85A/F87A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false pab1-paa1-1 3272619 N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-par1-2 3272620 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q10428:p.Gly367Ala G367A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q10428:p.Gly367Val G367V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Lys379Ala;Val381Ala;Phe383Ala] K379A/V381A/F383A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Ala;Lys379Ala;Val381Ala;Phe383Ala] G367A/K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.[Gly367Val;Lys379Ala;Val381Ala;Phe383Ala] G367V/K379A/V381A/F383A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q10428:p.Ser378Asp S378D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-paa1-4 3272621 N/A 3272635 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272642 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272632 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false pab1-paa1-2 3272622 N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-paa1-5 3272623 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false dis2-paa1-6 3272624 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false pab1-dis2-4 3272625 N/A 3272633 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false paa1-par1-1 3272626 N/A 3272635 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-paa1-1 3272627 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false par1-paa1-2 3272628 N/A 3272635 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-pab1-2 3272629 N/A 3272633 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272634 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false dis2-paa1-7 3272630 N/A 3272635 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272643 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272644 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272642 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272632 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272639 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false paa1-dis2-3 3272631 N/A 3272639 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3272633 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false