DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nagae-2014-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. DIP original experiment: DIP-264345X Structure (London, England : 1993) 2014 IMEx A platform of C-type lectin-like receptor CLEC-2 for binding O-glycosylated podoplanin and nonglycosylated rhodocytin. Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. Only protein-protein interactions imex curation nagae-2014-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. DIP original experiment: DIP-264347X Structure (London, England : 1993) 2014 IMEx A platform of C-type lectin-like receptor CLEC-2 for binding O-glycosylated podoplanin and nonglycosylated rhodocytin. Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. Only protein-protein interactions imex curation nagae-2014-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. DIP original experiment: DIP-264346X Structure (London, England : 1993) 2014 IMEx A platform of C-type lectin-like receptor CLEC-2 for binding O-glycosylated podoplanin and nonglycosylated rhodocytin. Nagae M., Morita-Matsumoto K., Kato M., Kaneko MK., Kato Y., Yamaguchi Y. Only protein-protein interactions imex curation pdpn_human Podoplanin Glycoprotein 36 PA2.26 antigen T1-alpha Aggrus PDPN GP36 PSEC0003 PSEC0025 protein protein human Homo sapiens Human MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP q9p126-1 C-type lectin domain family 1 member B CLEC1B CLEC2 UNQ721/PRO1384 C-type lectin-like receptor 2 protein protein human Homo sapiens Human MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP slyb_calrh Snaclec rhodocytin subunit beta Aggretin beta chain Rhodoaggretin subunit beta protein protein calrh Calloselasma rhodostoma Malayan pit viper Agkistrodon rhodostoma MGRFIFVSFGLLVVFLSLSGTGADCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA slya_calrh Snaclec rhodocytin subunit alpha Aggretin alpha chain Rhodoaggretin subunit alpha protein protein calrh Calloselasma rhodostoma Malayan pit viper Agkistrodon rhodostoma GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY clec1b-pdpn-1 3272286 N/A 3272289 unspecified role unspecified role unspecified role unspecified role Thr52 Thr52 oglycothr O-glycosyl-L-threonine OGlycoThr certain certain sequence position certain certain certain sequence position certain false Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272290 unspecified role unspecified role unspecified role unspecified role Region 96-221 Region 96-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false clec1b-slya_calrh-1 3272287 N/A 3272290 unspecified role unspecified role unspecified role unspecified role Region 96-221 Region 96-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3272291 unspecified role unspecified role unspecified role unspecified role calrh Calloselasma rhodostoma Malayan pit viper Agkistrodon rhodostoma N/A 3272292 unspecified role unspecified role unspecified role unspecified role calrh Calloselasma rhodostoma Malayan pit viper Agkistrodon rhodostoma physical association physical association false false false clec1b-pdpn-2 3272288 N/A 3272289 unspecified role unspecified role unspecified role unspecified role Thr52 Thr52 oglycothr O-glycosyl-L-threonine OGlycoThr certain certain sequence position certain certain certain sequence position certain false Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272290 unspecified role unspecified role unspecified role unspecified role Region 96-221 Region 96-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false