DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mouro-2014-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265535X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265533X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265539X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265537X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265541X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265536X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-7 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265534X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265540X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-9 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265538X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation mouro-2014-10 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mourão A., Nager AR., Nachury MV., Lorentzen E. DIP original experiment: DIP-265542X Nature structural & molecular biology 2014 IMEx Structural basis for membrane targeting of the BBSome by ARL6. Mourão A., Nager AR., Nachury MV., Lorentzen E. Only protein-protein interactions imex curation a8jf99_chlre BBS3B CHLREDRAFT_24475 CHLRE_16g664500v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MGFFDKLLSLFGMSGKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS a8jea1_chlre BBS1 CHLREDRAFT_132537 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MVHESNPNDYAAGDAGNASGRYTTGSNGIPPMLPSVKSVWLDAFNDPVAGISAYTPCVHTCNLFGDGENRLVIADEDRKLKIWKGTQKASEHPLLDTPVAICSYISENTAPRLPALAVAAGSHIYIYRNLRPYYKFVLPPENVNTEEQDIWQKVMEGEIVIGEAVAQLTRLQVRAGDAGVVLQTRSLQLMNIGDPDAKMAFVEHWQGQPLVATTVITCMDVVKQAIDEPDAVSCLVVGTESGRILILNPAGTAIVKNIWVGITPAMIAVQGELDVGYRITVAGRDGKLYHIRNGELSQTIIQLEAQPVGLVRLAKHVAVGCMNDVVHAYTPTGHKSWSLYLPCHILAMQRMEVTGQRNTKALIVALSNGEVRVYNEKLLVSVHVSPNPVTALWFGRYGREDNTLLAITKSGALDIKMLPRTANLEAGAIGGGPPPEQEIPLAVPKKTRLYVEQTQREREQAADMHRTFQRDLAKLRLTTARAYVKVLTDGQGAAAFTTNTNLSLSLNIAGLGPRFRLSLLLRNDGSTQLNDIPVALRADAGLYSLGKTQFTIPFLVPGLQYTFEVPVTAIDPMAGTGTITVLLLAPGGVSSSAPLLQAQIKMPMSEPEEVE bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA q9h0f7-1 ADP-ribosylation factor-like protein 6 ARL6 BBS3 Bardet-Biedl syndrome 3 protein BBS3 protein protein human Homo sapiens Human MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT bbs4_bovin Bardet-Biedl syndrome 4 protein homolog BBS4 protein protein bovin Bos taurus (Bovine) Bovine MAEEKLSARTQLPVSAESQKPVLKKAPEFPILEKQNWLIHLYYIQKDYEACKAVIKEQLQETHGLCEYAIYVQALIFRLEGNIQESLRLFQMCAFLSPQCADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEICHNLGVCYIYLKQFDKAQDQLHNALHLNRHDLTYIMLGKIFLLKGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNTLTYDPTNYKAILAAGSMMQTHGDFDVALTKYKVVACAVIESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPLDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDSENAKRAYEEAVRLDKCNPLVNLNYAVLLYNQGEKRDALAQYQEMEKKVNLLKYSSSLEFDPEMVEVAQKLGAALQVGEALVWTKPVKDPKSKHQTASTSKAAGFQQPLGSNQALGQAMSSAATCRKLSSGAGGTSQLTKPPSLPLEPEPTVEAQPTEASAQTREK bbs1-bbs3b-1 3271391 N/A 3271401 unspecified role unspecified role unspecified role unspecified role Region 16-180 Region 16-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region 1-425 Region 1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false bbs1-bbs3b-2 3271392 N/A 3271401 unspecified role unspecified role unspecified role unspecified role Region 16-180 Region 16-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region 1-425 Region 1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false arl6-bbs1-6 3271393 N/A 3271403 unspecified role unspecified role unspecified role unspecified role Region 1-417 Region 1-417 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8NFJ9:p.Met390Arg M390R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3271404 unspecified role unspecified role unspecified role unspecified role Region 16-186 Region 16-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arl6-bbs1-10 3271394 N/A 3271404 unspecified role unspecified role unspecified role unspecified role Region 16-186 Region 16-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region 1-425 Region 1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false arl6-bbs1-11 3271395 N/A 3271403 unspecified role unspecified role prey prey Region 1-417 Region 1-417 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8NFJ9:p.Ile399Glu I399E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q8NFJ9:p.Arg404Ala R404A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8NFJ9:p.Met390Arg M390R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3271404 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false bbs1-bbs3b-3 3271396 N/A 3271401 unspecified role unspecified role unspecified role unspecified role Region 16-180 Region 16-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region 1-425 Region 1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false bbs1-bbs3b-4 3271397 N/A 3271401 unspecified role unspecified role unspecified role unspecified role Region 16-180 Region 16-180 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region 1-425 Region 1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false arl6-bbs1-12 3271398 N/A 3271403 unspecified role unspecified role unspecified role unspecified role Region 1-417 Region 1-417 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8NFJ9:p.Met390Arg M390R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3271404 unspecified role unspecified role unspecified role unspecified role Region 16-186 Region 16-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arl6-bbs1-13 3271399 N/A 3271404 unspecified role unspecified role unspecified role unspecified role Region 16-186 Region 16-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3271402 unspecified role unspecified role unspecified role unspecified role Region1-425 Region1-425 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false arl6-bbs4-2 3271400 N/A 3271405 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine N/A 3271404 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 16-186 Region 16-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9H0F7-1:p.Arg77Ala R77A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9H0F7-1:p.Leu100Glu L100E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9H0F7-1:p.Glu108Ala E108A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false