DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ izawa-2015-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265165X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265177X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265171X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Izawa D., Pines J. DIP original experiment: DIP-265174X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265178X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265166X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265172X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-8 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Izawa D., Pines J. DIP original experiment: DIP-265175X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265180X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-10 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265169X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-11 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265179X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-12 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265167X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-13 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265170X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Izawa D., Pines J. DIP original experiment: DIP-265173X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-15 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265176X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation izawa-2015-16 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Izawa D., Pines J. DIP original experiment: DIP-265168X Nature 2015 IMEx The mitotic checkpoint complex binds a second CDC20 to inhibit active APC/C. Izawa D., Pines J. Only protein-protein interactions imex curation cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF apc4_human Anaphase-promoting complex subunit 4 APC4 Cyclosome subunit 4 ANAPC4 protein protein human Homo sapiens Human MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS bub1b_human Mitotic checkpoint serine/threonine-protein kinase BUB1 beta MAD3/BUB1-related protein kinase Mitotic checkpoint kinase MAD3L SSK1 BUB1B BUBR1 MAD3L Protein SSK1 protein protein human Homo sapiens Human MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND bub3_human Mitotic checkpoint protein BUB3 BUB3 protein protein human Homo sapiens Human MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT anapc4-cdc27-1 3271168 N/A 3271184 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false bub1b-cdc20-5 3271169 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false bub1b-cdc20-6 3271170 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false bub1b-cdc20-7 3271171 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false anapc4-bub1b-1 3271172 N/A 3271186 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271188 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271184 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false bub1b-cdc20-8 3271173 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false cdc20-anapc4-1 3271174 N/A 3271186 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271185 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271187 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3271188 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false bub1b-bub3-3 3271175 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271189 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false anapc4-bub1b-2 3271176 N/A 3271186 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false anapc4-bub1b-3 3271177 N/A 3271186 unspecified role unspecified role prey prey SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false anapc4-bub1b-4 3271178 N/A 3271186 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271184 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false bub1b-cdc20-9 3271179 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false anapc4-cdc20-1 3271180 N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false bub1b-anapc4-2 3271181 N/A 3271186 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3271185 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3271188 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false bub1b-bub3-4 3271182 N/A 3271186 unspecified role unspecified role bait bait SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271189 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false anapc4-bub1b-5 3271183 N/A 3271186 unspecified role unspecified role prey prey SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271185 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3271187 unspecified role unspecified role prey prey SBP-tag SBP-tag sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271187 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3271188 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false